DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and Prrxl1

DIOPT Version :9

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:XP_006518472.1 Gene:Prrxl1 / 107751 MGIID:2148204 Length:354 Species:Mus musculus


Alignment Length:131 Identity:61/131 - (46%)
Similarity:72/131 - (54%) Gaps:29/131 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 PAPCSGNLPAGGGHHS----------RKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATK 153
            |....|..|.  |:||          ||.|||||||:..||.|||.||.:|||||.|.|||||.|
Mouse    98 PPQLEGTAPF--GNHSTGDFDDGFLRRKQRRNRTTFTLQQLEALEAVFAQTHYPDVFTREELAMK 160

  Fly   154 VHLSEARVQVWFQNRRAKFRRNERSVGSRTLLDTAP-------QLVPAPISNNMHKYANMPHPHP 211
            ::|:||||||||||||||:|:.||...     |..|       ::.|.|:.|     .|.|.|..
Mouse   161 INLTEARVQVWFQNRRAKWRKTERGAS-----DQEPGAKEPMAEVTPPPVRN-----INSPPPGD 215

  Fly   212 Q 212
            |
Mouse   216 Q 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 38/51 (75%)
Prrxl1XP_006518472.1 Homeobox 128..181 CDD:365835 38/52 (73%)
OAR 292..309 CDD:367680
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.