DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and CDX4

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_005184.1 Gene:CDX4 / 1046 HGNCID:1808 Length:284 Species:Homo sapiens


Alignment Length:181 Identity:49/181 - (27%)
Similarity:67/181 - (37%) Gaps:50/181 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 SNFGPTGAGCGGADRPAPCSGNL-PAGGG----------HHS---------------RKPRRNRT 122
            ||.||.|.|..|:..|....|:| |...|          .||               |...:.|.
Human   114 SNLGPVGGGTSGSSLPGQAGGSLVPTDAGAAKASSPSRSRHSPYAWMRKTVQVTGKTRTKEKYRV 178

  Fly   123 TFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRN--------ERSV 179
            .::..|...|||.|....|.....:.|||..:.|||.:|::||||||||.|:.        |.|.
Human   179 VYTDHQRLELEKEFHCNRYITIQRKSELAVNLGLSERQVKIWFQNRRAKERKMIKKKISQFENSG 243

  Fly   180 GSRTLLDTAPQLVPAPISNNMHKYANMPHPHPQPPPPPGAYALNFGPLELR 230
            ||  :...:..:.|..:.|...             ..|.| ...|.|:|::
Human   244 GS--VQSDSDSISPGELPNTFF-------------TTPSA-VRGFQPIEIQ 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 22/55 (40%)
CDX4NP_005184.1 Caudal_act 13..170 CDD:461413 14/55 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 15..40
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..155 8/34 (24%)
Homeodomain 175..230 CDD:459649 22/54 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 238..259 5/22 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.