DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and prrx1

DIOPT Version :9

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:XP_004913839.1 Gene:prrx1 / 100494324 XenbaseID:XB-GENE-484663 Length:248 Species:Xenopus tropicalis


Alignment Length:264 Identity:97/264 - (36%)
Similarity:128/264 - (48%) Gaps:64/264 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SSHQSHNLESEDKLEDREESG-----RNLDKIHRFSVDNIMEMKHDAYSKGKMAMELSSNFGPTG 90
            ||:..|.|:.:..|..|.||.     .||.....|||.::::::......|..|.:         
 Frog     3 SSYNHHVLDRQGPLGSRLESPITASLDNLQAKKNFSVSHLLDLEEAGEMVGAQAED--------- 58

  Fly    91 AGCGGADRPAPCSGNLPAGGG-------------HHSRKPRRNRTTFSSAQLTALEKVFERTHYP 142
             |.|.|.|....|..|.:|..             ...||.|||||||:|:||.|||:||||||||
 Frog    59 -GSGEAGRSLLESPGLTSGSDTPQQENEQMNAEQKKKRKQRRNRTTFNSSQLQALERVFERTHYP 122

  Fly   143 DAFVREELATKVHLSEARVQVWFQNRRAKFRRNERSV---GSRTLLDTAPQLVPA---PISNNMH 201
            ||||||:||.:|:|:||||||||||||||||||||::   .:.:||.:....|.|   ||.    
 Frog   123 DAFVREDLARRVNLTEARVQVWFQNRRAKFRRNERAMLANKNASLLKSYAGDVTAVEQPIV---- 183

  Fly   202 KYANMPHPHPQPPPPPGAYALNFGPLELRSCQNYTNCYGGFGSSGASGSGVCSFFGATNYCVAAN 266
                     |:|.|.|..| |::|     :...|        |:.|:.|..|:   .||.....|
 Frog   184 ---------PRPAPRPNEY-LSWG-----TASPY--------SAMATYSSTCA---NTNPAQGMN 222

  Fly   267 YAKN 270
            .|.:
 Frog   223 MANS 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 42/51 (82%)
prrx1XP_004913839.1 Homeobox 102..154 CDD:365835 42/51 (82%)
OAR 221..238 CDD:367680 2/6 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 103 1.000 Domainoid score I6720
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 122 1.000 Inparanoid score I4597
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 1 1.000 - - otm48701
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5800
SonicParanoid 1 1.000 - - X3194
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.990

Return to query results.
Submit another query.