DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and drgx

DIOPT Version :9

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:XP_004915967.1 Gene:drgx / 100493837 XenbaseID:XB-GENE-993712 Length:263 Species:Xenopus tropicalis


Alignment Length:200 Identity:75/200 - (37%)
Similarity:92/200 - (46%) Gaps:44/200 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 GNLPAGG--------GHHSRKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEAR 160
            |:.|.|.        |...||.|||||||:..||.|||.||.:|||||.|.|||||.|::|:|||
 Frog    13 GSPPFGAHAASEFDDGFLRRKQRRNRTTFTLQQLEALEAVFAQTHYPDVFTREELAMKINLTEAR 77

  Fly   161 VQVWFQNRRAKFRRNER-SVGSRTLLDTAPQLVPAPISNNMHKYANMPHPHPQPPPPPG------ 218
            |||||||||||:|:.|| |.......::||::..|  ..|:       .|.....|..|      
 Frog    78 VQVWFQNRRAKWRKTERGSCEQEGAKESAPEVTTA--GRNL-------SPSSTVEPVRGKKETLE 133

  Fly   219 ------------AYALNFGPLELRSCQNYTNCYGGFGSSGAS--GSGVCSFFGATNYCVAANYAK 269
                        ..|.:|.|..|......|..|....|..||  ||.:||      .||:.....
 Frog   134 AQQRCLSHDRAVGSATSFFPSCLPGALLNTASYAQALSHVASLKGSPLCS------CCVSDPLGL 192

  Fly   270 NAYPP 274
            :..||
 Frog   193 SFLPP 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 38/51 (75%)
drgxXP_004915967.1 Homeobox 38..91 CDD:395001 38/52 (73%)
OAR 204..220 CDD:397759
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.