DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and dbx2

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:XP_002932867.1 Gene:dbx2 / 100489622 XenbaseID:XB-GENE-481734 Length:251 Species:Xenopus tropicalis


Alignment Length:113 Identity:45/113 - (39%)
Similarity:61/113 - (53%) Gaps:13/113 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 AGCGGA-DRPA-----PCSGNL-PAGGGHHSRKPRR---NRTTFSSAQLTALEKVFERTHYPDAF 145
            |.|||: ..||     |.:..| |..|...|.|.||   .|..||..|..:|||:|::..|....
 Frog   126 ACCGGSCQHPASPTAFPRNEMLPPLCGQDASSKTRRVILRRAVFSEEQRKSLEKMFQKQKYISKV 190

  Fly   146 VREELATKVHLSEARVQVWFQNRRAKFRRN-ERSVGSRTLL--DTAPQ 190
            .|:.||..:.|.|::|::||||||.|:|.: |:||.|...|  |:|.|
 Frog   191 DRKNLAVNLALKESQVKIWFQNRRMKWRNSKEKSVLSNKFLKEDSAEQ 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 24/58 (41%)
dbx2XP_002932867.1 Homeodomain 165..219 CDD:459649 22/53 (42%)

Return to query results.
Submit another query.