DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and prrx2

DIOPT Version :9

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:XP_002940803.1 Gene:prrx2 / 100488907 XenbaseID:XB-GENE-947362 Length:248 Species:Xenopus tropicalis


Alignment Length:205 Identity:79/205 - (38%)
Similarity:107/205 - (52%) Gaps:52/205 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 FSVDNIMEMKHDAYSKGKMAMELSSNFG---------PTGAGC---------GGADRPAPCSGNL 106
            |||.::::::..|     ..|:.:::..         |...|.         ||:..|   |.|.
 Frog    31 FSVSHLLDLEEAA-----AGMQTTADMAAPTEDEDKEPASGGSSDSEVTIHEGGSPNP---SSNK 87

  Fly   107 PAGGGHHSRKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAK 171
            .:|    .:|.|||||||:|:||.|||:||||||||||||||:||.:|.||||||||||||||||
 Frog    88 SSG----KKKQRRNRTTFNSSQLQALERVFERTHYPDAFVREDLARRVSLSEARVQVWFQNRRAK 148

  Fly   172 FRRNERS-VGSRTLL-------DTAPQLVPAPIS----------NNMHKYANMPHPHPQPPPPPG 218
            ||||||: :.||:..       ||..:...:|.:          |:...|:|.    ..||..|.
 Frog   149 FRRNERAMLASRSATHLKSYSQDTGAEQQVSPRASTLTPEYMPWNSNSNYSNA----SLPPYSPT 209

  Fly   219 AYALNFGPLE 228
            ..|.:..|.:
 Frog   210 TTATSTAPTQ 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 43/51 (84%)
prrx2XP_002940803.1 Homeobox 98..151 CDD:365835 44/52 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 103 1.000 Domainoid score I6720
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 122 1.000 Inparanoid score I4597
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 1 1.000 - - otm48701
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3194
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.