| Sequence 1: | NP_611756.1 | Gene: | CG9876 / 37668 | FlyBaseID: | FBgn0034821 | Length: | 275 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_004911874.1 | Gene: | shox / 100486480 | XenbaseID: | XB-GENE-920752 | Length: | 334 | Species: | Xenopus tropicalis |
| Alignment Length: | 144 | Identity: | 57/144 - (39%) |
|---|---|---|---|
| Similarity: | 71/144 - (49%) | Gaps: | 40/144 - (27%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 111 GHHSRKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEARVQVWFQNRRAKFRRN 175
Fly 176 ERSV---GSRTLLDTAPQLVPAPISNNMHKYANM-----------------------PHPHPQ-- 212
Fly 213 --------PPPPPG 218 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG9876 | NP_611756.1 | Homeodomain | 118..174 | CDD:459649 | 37/55 (67%) |
| shox | XP_004911874.1 | Homeodomain | 157..213 | CDD:459649 | 37/55 (67%) |
| OAR | 314..330 | CDD:461067 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||