DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and arxb

DIOPT Version :10

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:XP_002667096.1 Gene:arxb / 100329907 ZFINID:ZDB-GENE-121109-2 Length:385 Species:Danio rerio


Alignment Length:218 Identity:75/218 - (34%)
Similarity:102/218 - (46%) Gaps:59/218 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 SHQSHNLESEDKLEDREESGRNLDKIHRFSVDNI-MEMKHDAYSKGKMAMELSSNFGPTGAGCGG 95
            |:|.|  .|.......||.|.::     ....|: ::.:.:|:.|......||:          |
Zfish   103 SYQEH--ASCKNTPINEEEGADI-----CGETNVTLKQEREAFLKNSEETSLSA----------G 150

  Fly    96 ADRPAPCSGNLPAGGGHHSRKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEAR 160
            :|          ...|...||.||.||||:|.||..||:.|::|||||.|.|||||.::.|:|||
Zfish   151 SD----------TEDGMLKRKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREELAMRLDLTEAR 205

  Fly   161 VQVWFQNRRAKFRRNER-SVGSRTL---LDTAPQLVPAPISNNMHKYAN----MPHPHPQ----- 212
            |||||||||||:|:.|: .|...||   ...||     |.:.::..|.:    :|:|||.     
Zfish   206 VQVWFQNRRAKWRKREKVGVQPHTLSLHYSGAP-----PAAQSLCHYLSGNPFVPNPHPAIDSAW 265

  Fly   213 PPP-------------PPGAYAL 222
            |.|             |||..||
Zfish   266 PAPFQRLAQPAQNSVSPPGFSAL 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeodomain 118..174 CDD:459649 38/55 (69%)
arxbXP_002667096.1 Homeodomain 163..219 CDD:459649 38/55 (69%)
OAR 351..369 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.