DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9876 and arxb

DIOPT Version :9

Sequence 1:NP_611756.1 Gene:CG9876 / 37668 FlyBaseID:FBgn0034821 Length:275 Species:Drosophila melanogaster
Sequence 2:XP_002667096.1 Gene:arxb / 100329907 ZFINID:ZDB-GENE-121109-2 Length:385 Species:Danio rerio


Alignment Length:218 Identity:75/218 - (34%)
Similarity:102/218 - (46%) Gaps:59/218 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 SHQSHNLESEDKLEDREESGRNLDKIHRFSVDNI-MEMKHDAYSKGKMAMELSSNFGPTGAGCGG 95
            |:|.|  .|.......||.|.::     ....|: ::.:.:|:.|......||:          |
Zfish   103 SYQEH--ASCKNTPINEEEGADI-----CGETNVTLKQEREAFLKNSEETSLSA----------G 150

  Fly    96 ADRPAPCSGNLPAGGGHHSRKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEAR 160
            :|          ...|...||.||.||||:|.||..||:.|::|||||.|.|||||.::.|:|||
Zfish   151 SD----------TEDGMLKRKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREELAMRLDLTEAR 205

  Fly   161 VQVWFQNRRAKFRRNER-SVGSRTL---LDTAPQLVPAPISNNMHKYAN----MPHPHPQ----- 212
            |||||||||||:|:.|: .|...||   ...||     |.:.::..|.:    :|:|||.     
Zfish   206 VQVWFQNRRAKWRKREKVGVQPHTLSLHYSGAP-----PAAQSLCHYLSGNPFVPNPHPAIDSAW 265

  Fly   213 PPP-------------PPGAYAL 222
            |.|             |||..||
Zfish   266 PAPFQRLAQPAQNSVSPPGFSAL 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9876NP_611756.1 Homeobox 121..173 CDD:278475 36/51 (71%)
arxbXP_002667096.1 Homeobox 166..218 CDD:278475 36/51 (71%)
OAR 351..368 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.