Sequence 1: | NP_611756.1 | Gene: | CG9876 / 37668 | FlyBaseID: | FBgn0034821 | Length: | 275 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_002667096.1 | Gene: | arxb / 100329907 | ZFINID: | ZDB-GENE-121109-2 | Length: | 385 | Species: | Danio rerio |
Alignment Length: | 218 | Identity: | 75/218 - (34%) |
---|---|---|---|
Similarity: | 102/218 - (46%) | Gaps: | 59/218 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 SHQSHNLESEDKLEDREESGRNLDKIHRFSVDNI-MEMKHDAYSKGKMAMELSSNFGPTGAGCGG 95
Fly 96 ADRPAPCSGNLPAGGGHHSRKPRRNRTTFSSAQLTALEKVFERTHYPDAFVREELATKVHLSEAR 160
Fly 161 VQVWFQNRRAKFRRNER-SVGSRTL---LDTAPQLVPAPISNNMHKYAN----MPHPHPQ----- 212
Fly 213 PPP-------------PPGAYAL 222 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9876 | NP_611756.1 | Homeobox | 121..173 | CDD:278475 | 36/51 (71%) |
arxb | XP_002667096.1 | Homeobox | 166..218 | CDD:278475 | 36/51 (71%) |
OAR | 351..368 | CDD:281777 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24329 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 3.010 |