DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art7 and TMT1

DIOPT Version :9

Sequence 1:NP_611753.4 Gene:Art7 / 37664 FlyBaseID:FBgn0034817 Length:690 Species:Drosophila melanogaster
Sequence 2:NP_011102.3 Gene:TMT1 / 856922 SGDID:S000000977 Length:299 Species:Saccharomyces cerevisiae


Alignment Length:280 Identity:55/280 - (19%)
Similarity:88/280 - (31%) Gaps:91/280 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 YNHAHAELLTEDALCIPARA--------RCYAQVAQSPLAAQWNSLKTIANL-DGEPLLHPPEQL 212
            |:....:||. |..|.|..|        :.:.|:..|.|:|  ..:||...: :|.     |:..
Yeast    32 YHDGERKLLV-DVGCGPGTATLQMAQELKPFEQIIGSDLSA--TMIKTAEVIKEGS-----PDTY 88

  Fly   213 KSCQGEAALHDVQLSQLPSSAFRPLTDPVEIFQFDFQRKQEREKQRSQLLKLQSKQPGAAELVFY 277
            |:...:.:..|                     .|.|......:||:..::.       |.|.. :
Yeast    89 KNVSFKISSSD---------------------DFKFLGADSVDKQKIDMIT-------AVECA-H 124

  Fly   278 WWDIQ---------LDDDGEILLSCAPYWA--------HPQLKELAAEKAKDHPLPNVVPWRDHW 325
            |:|.:         |..||.|.:     |.        :|:..:|..|          ||:....
Yeast   125 WFDFEKFQRSAYANLRKDGTIAI-----WGYADPIFPDYPEFDDLMIE----------VPYGKQG 174

  Fly   326 MQAIYYIPKPLQLLEAGKSFHL--SCHHDEYSLWFDAREEAPTKSVRRHT---------CTCDLH 379
            :...:..|...:|....|..||  ...||....:|.|.:......:.:||         .|....
Yeast   175 LGPYWEQPGRSRLRNMLKDSHLDPELFHDIQVSYFCAEDVRDKVKLHQHTKKPLLIRKQVTLVEF 239

  Fly   380 MTYSR--SRIGQLNQSPRNK 397
            ..|.|  |...|..|.|:||
Yeast   240 ADYVRTWSAYHQWKQDPKNK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art7NP_611753.4 AdoMet_MTases 36..>186 CDD:302624 8/36 (22%)
TMT1NP_011102.3 AdoMet_MTases 33..>147 CDD:418430 28/150 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.