DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art7 and CRG1

DIOPT Version :9

Sequence 1:NP_611753.4 Gene:Art7 / 37664 FlyBaseID:FBgn0034817 Length:690 Species:Drosophila melanogaster
Sequence 2:NP_012079.1 Gene:CRG1 / 856616 SGDID:S000001252 Length:291 Species:Saccharomyces cerevisiae


Alignment Length:307 Identity:56/307 - (18%)
Similarity:99/307 - (32%) Gaps:94/307 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 GREVHVLDIGTGTGILSMMA-----LAAGADSVTACEAFLPMANCAE----------KILAANGA 112
            |....::|||.|||..:.:.     ...|.|..:|      |.:.||          ||...|..
Yeast    37 GTRKSLVDIGCGTGKATFVVEPYFKEVIGIDPSSA------MLSIAEKETNERRLDKKIRFINAP 95

  Fly   113 GDKVRLIRKRSTEIQVGEDMPRKANL-LVAELLDTELIGEGAIGIYNHAHAELLTEDALCIPARA 176
            |:.:..||..|.::.:..:.....|| .:.:.:.:.|..:|....:.:...|.:.     .|...
Yeast    96 GEDLSSIRPESVDMVISAEAIHWCNLERLFQQVSSILRSDGTFAFWFYIQPEFVD-----FPEAL 155

  Fly   177 RCYAQVAQSPLAAQW-----------NSLKTIANLDGEPLLHPPEQLKSCQGEAALHDVQLSQLP 230
            ..|.:..       |           |..:.:.|..||.|            .:.|.| :...:.
Yeast   156 NVYYKYG-------WSKDYMGKYLNDNQREILLNYGGEKL------------RSLLSD-RFGDIE 200

  Fly   231 SSAFRPLTDPVEIFQFDFQRKQEREKQRSQLLKLQSKQPGAAELVFYW-WDIQLDDDGEILLSCA 294
            .:.:.| :||                 .:..:..::.|       |.| ..|.|:...|.:.|.:
Yeast   201 VTIYSP-SDP-----------------NASTVTAENSQ-------FLWRAAITLNQFKEFVKSWS 240

  Fly   295 PY--WAH-----PQLKELAAEKAKD--HPLPNVVPWRDHWMQAIYYI 332
            .|  ||.     |.:.::...:.|:  |.....||.:..| ...||:
Yeast   241 IYTSWARDNPSKPDIADIFINELKEICHCEDLNVPLKIEW-STFYYL 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art7NP_611753.4 AdoMet_MTases 36..>186 CDD:302624 27/138 (20%)
CRG1NP_012079.1 Methyltransf_11 43..140 CDD:400514 23/102 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.