powered by:
Protein Alignment Art7 and BUD23
DIOPT Version :9
Sequence 1: | NP_611753.4 |
Gene: | Art7 / 37664 |
FlyBaseID: | FBgn0034817 |
Length: | 690 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_009976.1 |
Gene: | BUD23 / 850414 |
SGDID: | S000000643 |
Length: | 275 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 30 |
Identity: | 9/30 - (30%) |
Similarity: | 16/30 - (53%) |
Gaps: | 1/30 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 578 LSEPQEVLSVD-FSNFGQEHSLKGSIELKH 606
:|.|:|:...: |.|..:.|...||..::|
Yeast 1 MSRPEELAPPEIFYNDSEAHKYTGSTRVQH 30
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0500 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.