DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art7 and ndufaf5

DIOPT Version :9

Sequence 1:NP_611753.4 Gene:Art7 / 37664 FlyBaseID:FBgn0034817 Length:690 Species:Drosophila melanogaster
Sequence 2:NP_001076363.1 Gene:ndufaf5 / 794020 ZFINID:ZDB-GENE-070410-110 Length:321 Species:Danio rerio


Alignment Length:377 Identity:71/377 - (18%)
Similarity:117/377 - (31%) Gaps:124/377 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSCFSHVMNPITGQNSWQER---GDDYDYHLEVANAGFGDMLHDWERNQKYFAAL-----RKTIA 57
            |:.|...|.  ..|..|...   ...|||..|...:...|.::|..|.  :..||     |..||
Zfish    24 MNVFDRSMK--RRQKDWASSLLDSSKYDYLREEVGSRVADRVYDVART--FPLALDVGCGRSHIA 84

  Fly    58 G--MREAGREVHVLDIGTGTGILSMMALAAGADSVTACEAFLPM-ANCAEKILAANGAGDKVRLI 119
            .  .:|....:.:.|| :.:.:.:.......|..|.|.|.|||. .|..:.:|:           
Zfish    85 EHLSKEVVERLFLTDI-SSSSLRNRKTSDIPAQCVMADEEFLPFKENTFDLVLS----------- 137

  Fly   120 RKRSTEIQVGEDMPRKANLLVAELLDTELIGEGAIGIYNHAHAELLTEDALCIPA--------RA 176
               |..:....|:|                     |.....| ::|..|.:.|.|        ..
Zfish   138 ---SLSMHWINDLP---------------------GALRQIH-QVLKPDGVFIGAMVGGETLYEL 177

  Fly   177 RCYAQVAQ-------SPLAAQWNSLKTIANLDGEPLLHPPEQLKSCQGEAALHDVQLSQLPSSAF 234
            ||..|:|:       :|..:.:.::..:.||.|:                            :.|
Zfish   178 RCSLQLAELEREGGFAPHISPYTAVTDLGNLLGQ----------------------------AGF 214

  Fly   235 RPLTDPVEIFQFDFQRKQEREKQRSQLLKLQSKQPGAAELVFYWWDIQLDDDGEILLSCAPYWAH 299
            ..||..::..|.::          ..:|::.....|..|....|....|.....:|.:.|.|   
Zfish   215 NMLTVDIDEVQVNY----------PGMLEVMRDLQGMGESNCAWNRKLLLQRDTMLAAAAIY--- 266

  Fly   300 PQLKELAAEKAKDHPLP------NVVPWRDHWMQAIYYIPKPLQLLEAGKSF 345
               ||:...  :|..:|      .::.|:.|..||     ||.:...|..||
Zfish   267 ---KEMYGN--EDGSVPATFQILYMIGWKPHDSQA-----KPAKRGSANVSF 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art7NP_611753.4 AdoMet_MTases 36..>186 CDD:302624 33/172 (19%)
ndufaf5NP_001076363.1 BioC 67..290 CDD:273953 51/307 (17%)
Methyltransf_11 74..165 CDD:285453 23/127 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.