DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art7 and Mettl7a1

DIOPT Version :9

Sequence 1:NP_611753.4 Gene:Art7 / 37664 FlyBaseID:FBgn0034817 Length:690 Species:Drosophila melanogaster
Sequence 2:NP_081610.2 Gene:Mettl7a1 / 70152 MGIID:1916523 Length:244 Species:Mus musculus


Alignment Length:110 Identity:21/110 - (19%)
Similarity:34/110 - (30%) Gaps:47/110 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 NQKYFAALRKTIAGMRE-AG--REVHVLDIGTGTGI----------------------------- 77
            |::..:..|:..:.::| ||  .::.:|::|.|||.                             
Mouse    48 NEQMASQKRELFSNLQEFAGPSGKLTLLEVGCGTGANFKFYPPGCRVTCIDPNPNFEKFLFKSVA 112

  Fly    78 ------LSMMALAAGAD---------SVTACEAFLPMANCAEKIL 107
                  .....:|||.|         .|..|...|......||||
Mouse   113 ENRQLQFERFVVAAGEDMHQVTDGSVDVVVCTLVLCSVKNQEKIL 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art7NP_611753.4 AdoMet_MTases 36..>186 CDD:302624 21/110 (19%)
Mettl7a1NP_081610.2 SmtA 70..>187 CDD:223574 16/88 (18%)
Methyltransf_11 75..172 CDD:285453 16/83 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.