DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art7 and Ndufaf5

DIOPT Version :9

Sequence 1:NP_611753.4 Gene:Art7 / 37664 FlyBaseID:FBgn0034817 Length:690 Species:Drosophila melanogaster
Sequence 2:NP_081369.2 Gene:Ndufaf5 / 69487 MGIID:1916737 Length:343 Species:Mus musculus


Alignment Length:366 Identity:67/366 - (18%)
Similarity:112/366 - (30%) Gaps:126/366 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QNSWQERGDD---YDYHLEVANAGFGDMLHDWERNQKYFAALRKTIAGMREAGREVHVLDIGTGT 75
            |.:|..|..|   :||..|...:...|.::|..|:...                   .||||.|.
Mouse    55 QKNWAARQPDPMKFDYLKEEVGSRIADRVYDIARDFPL-------------------ALDIGCGR 100

  Fly    76 GILSMMALAAGADSVTACEAFLPMANCAEKILAANGAGDKVRLIRKRSTEIQV--------GEDM 132
            |.     :|...|..|..:.|  ..:.||..|             |.|.|..:        .|.:
Mouse   101 GY-----IAQHLDKETVGKIF--QTDIAEHAL-------------KNSLETDIPTVNILADEEFL 145

  Fly   133 PRKANL--LVAELLDTELIGEGAIGIYNHAHAELLTEDALCIPA--------RARCYAQVAQ--- 184
            |.:.|.  ||...|....:.:....: ...| .:|..|.:.:.|        ..||..|:|:   
Mouse   146 PFQENTFDLVVSSLSLHWVNDLPRAL-EQIH-YVLKPDGVFVGAMFGGDTLYELRCSLQLAETER 208

  Fly   185 ----SPLAAQWNSLKTIANLDGEPLLHPPEQLKSCQGEAALHDVQLSQLPSSAFRPLTDPVEIFQ 245
                ||..:.:.::..:.:|.|.                            :.|..||...:..|
Mouse   209 EGGFSPHISPFTAVNDLGHLLGR----------------------------AGFNTLTVDTDEIQ 245

  Fly   246 FDFQRKQEREKQRSQLLKLQSKQPGAAELVFYWWDIQLDDDGEILLSCAPYWAHPQLKELAAEKA 310
            .::          ..:.:|.....|..|....|....|.....:|.:.|.|      :|:  .:.
Mouse   246 VNY----------PGMFELMEDLKGMGESNCSWNRKALLHRDTMLAAAAVY------REM--YRN 292

  Fly   311 KDHPLP------NVVPWRDHWMQAIYYIPKPLQLLEAGKSF 345
            :|..:|      :::.|:.|..||     :|.:...|..||
Mouse   293 EDGSIPATFQIYHMIGWKYHDSQA-----RPAERGSATVSF 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art7NP_611753.4 AdoMet_MTases 36..>186 CDD:302624 33/174 (19%)
Ndufaf5NP_081369.2 BioC 93..310 CDD:273953 49/284 (17%)
Methyltransf_11 94..185 CDD:285453 25/112 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.