DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art7 and Mettl27

DIOPT Version :9

Sequence 1:NP_611753.4 Gene:Art7 / 37664 FlyBaseID:FBgn0034817 Length:690 Species:Drosophila melanogaster
Sequence 2:NP_001102969.1 Gene:Mettl27 / 688407 RGDID:1588881 Length:253 Species:Rattus norvegicus


Alignment Length:187 Identity:42/187 - (22%)
Similarity:68/187 - (36%) Gaps:51/187 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   403 LEESIEAEKSNVLVLGNGCLLGLASSALGAASVLLHEPHRFSRRLIESIVKHNQLKNVQFLD-KV 466
            |.::::....:.|:|...|..||.:..|.|...|                      .||.:| ..
  Rat    58 LSQALQGPPHDALILDVACGTGLVAVELQARGFL----------------------QVQGVDGSP 100

  Fly   467 EELEDSRLAALTH------IFAEPYFLNAILPWDNFYFGTLLTKIKDRLPEGVKISPCSARIYAL 525
            |.|:.:|...|.|      :..||      ||:....|..::  |...|.||.  .|||    |:
  Rat   101 EMLKQARARGLYHHLSLCTLGQEP------LPYPKGTFDAVI--IVGALSEGQ--VPCS----AI 151

  Fly   526 PVEFLDLHKIRAPVG-SCEGFDLRLFDEMVERSAEQAVSLVEAQPLWEYPCRALSEP 581
            |    :|.::..|.| .|........:...:.:.|.|:..:|....||   |.:::|
  Rat   152 P----ELLRVTKPGGLVCLTTRTNPSNLPYKEALEAALDSLEQAGAWE---RLVTQP 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art7NP_611753.4 AdoMet_MTases 36..>186 CDD:302624
Mettl27NP_001102969.1 Methyltransf_25 71..162 CDD:404528 31/130 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.