DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art7 and mettl27

DIOPT Version :9

Sequence 1:NP_611753.4 Gene:Art7 / 37664 FlyBaseID:FBgn0034817 Length:690 Species:Drosophila melanogaster
Sequence 2:XP_021324579.1 Gene:mettl27 / 678636 ZFINID:ZDB-GENE-060421-5918 Length:235 Species:Danio rerio


Alignment Length:291 Identity:58/291 - (19%)
Similarity:93/291 - (31%) Gaps:107/291 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FSHVMNPITGQNSWQERGDDYDYHLEVANAGFGDMLHDWERNQK-------YFAAL--RKTIAGM 59
            ||.|.|.|...:...|..|         ..||.|   .|..|.:       |.|.|  .:.::..
Zfish    15 FSDVRNVILSAHKNTEAQD---------KVGFYD---TWADNYEQDVAVLDYRAPLLAAECVSSF 67

  Fly    60 REAGRE-VHVLDIGTGTGILSMMALAAGADSVTACEAFLPMANCAEKILAANGAGDKVRLIRKRS 123
            ....|| ..|||:..|||::|......|.......:..|.|...|:|      .|     :.|:.
Zfish    68 FNDDREKATVLDVACGTGLVSKHLKRMGFRHFDGVDGSLRMLEGAKK------TG-----LYKQL 121

  Fly   124 TEIQVGED-MPRKANLLVAELLDTELIGEGAIGIYNHAHAELLTEDALCIPARARCYAQVAQSPL 187
            ....:|:| :|.|     ||..|..:| .||:.:                       .||....:
Zfish   122 MHCMLGQDRIPVK-----AETYDVVII-VGALSV-----------------------GQVPLKVI 157

  Fly   188 AAQWNSLK--------TIANLDGEPLLHPPEQLKSCQGEAALHDVQLSQLPSSAFRPLTDPVEIF 244
            ...|::.|        |.||.|.:.                 :..:|.|:               
Zfish   158 RELWDATKPGGYVCMTTRANTDNQK-----------------YKAELEQM--------------- 190

  Fly   245 QFDFQRKQEREKQRS-QLLKLQSKQPGAAEL 274
               .:..:|.:|.|| .:::::..:.|.:||
Zfish   191 ---IKALEEEQKWRSVAVVEVEEWERGVSEL 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art7NP_611753.4 AdoMet_MTases 36..>186 CDD:302624 34/160 (21%)
mettl27XP_021324579.1 Methyltransf_25 77..168 CDD:316196 28/130 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.