powered by:
Protein Alignment Art7 and Alkbh8
DIOPT Version :9
Sequence 1: | NP_611753.4 |
Gene: | Art7 / 37664 |
FlyBaseID: | FBgn0034817 |
Length: | 690 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_006509942.1 |
Gene: | Alkbh8 / 67667 |
MGIID: | 1914917 |
Length: | 709 |
Species: | Mus musculus |
Alignment Length: | 69 |
Identity: | 15/69 - (21%) |
Similarity: | 28/69 - (40%) |
Gaps: | 10/69 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 38 MLHDWERNQKYFAALRKTIAGMREAGREVHVLDIGTGT----------GILSMMALAAGADSVTA 92
:::.|...|:|.....|.:.|.|.:..:...|:..|.| |:....||:..:.|:|.
Mouse 545 LIYVWAMEQEYKNQKSKYLRGKRISQGDKDELNSATSTEEFLVNQTPEGVNEDPALSVNSSSITK 609
Fly 93 CEAF 96
.|.:
Mouse 610 EEEY 613
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0500 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.