DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art7 and Gstcd

DIOPT Version :9

Sequence 1:NP_611753.4 Gene:Art7 / 37664 FlyBaseID:FBgn0034817 Length:690 Species:Drosophila melanogaster
Sequence 2:NP_001343238.1 Gene:Gstcd / 67553 MGIID:1914803 Length:634 Species:Mus musculus


Alignment Length:300 Identity:56/300 - (18%)
Similarity:96/300 - (32%) Gaps:99/300 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 ELLTEDALCIPARARCYAQVAQSPLAAQWNSL------KTIANLDGEPLLHP---PEQLKSCQGE 218
            |||.....|:.|.|.          .:||..|      ..:.|...|...||   ||::...:  
Mouse   129 ELLGFKKTCLKACAE----------VSQWTRLCELTIPLAVENFLQESSEHPPTIPEEILELE-- 181

  Fly   219 AALHDVQLSQLPSSAFRPLTDPVEIFQFDFQRKQEREKQR-------SQLLKLQSKQPG------ 270
                            |.|::||.:...|..|:|:.::|:       |...|.:||...      
Mouse   182 ----------------RKLSEPVRVHNDDKLRRQKLKQQKAAGSEPPSGKGKAKSKASAQKTPKD 230

  Fly   271 ------AAELVFYWWDIQLDDDGEILLSCAPYWAHPQLKELAAEKAKDHPLPNVVPWRDHWMQAI 329
                  :.||...:..:.:.:|.          |....:.....|||...||   |....:.:.:
Mouse   231 LAAPSKSLELKVAFSKLTVQEDA----------AASNREPSHIRKAKAADLP---PLEHVFAEGL 282

  Fly   330 YYIPKPLQLLEAGKSFHLSCHH-------------DEYSL---WFDAREEAPTKSVRRHTCTCDL 378
            |:....:.||..       .||             :::.|   |:...:|.|  .|:.....|.:
Mouse   283 YFTLADIVLLPC-------IHHFLVIICKKFSEKLEQFPLLTSWYQRIQEVP--KVKTAASKCGI 338

  Fly   379 HMTYSRSRIGQLNQSPRNKRYLRYLEESIEAEKSNVLVLG 418
            :..|....:....:.|.|..     |.:...|:|:.|.:|
Mouse   339 YFLYLPELLNSARKQPVNSD-----EVAAVDEQSDPLFIG 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art7NP_611753.4 AdoMet_MTases 36..>186 CDD:302624 6/22 (27%)
GstcdNP_001343238.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 189..233 8/43 (19%)
GST_C_family <271..330 CDD:322082 12/70 (17%)
AdoMet_MTases 424..542 CDD:327401
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.