DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art7 and Bud23

DIOPT Version :9

Sequence 1:NP_611753.4 Gene:Art7 / 37664 FlyBaseID:FBgn0034817 Length:690 Species:Drosophila melanogaster
Sequence 2:XP_030110611.1 Gene:Bud23 / 66138 MGIID:1913388 Length:300 Species:Mus musculus


Alignment Length:286 Identity:54/286 - (18%)
Similarity:97/286 - (33%) Gaps:84/286 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 HDVQLSQLPSSAFRP-LTDPVEIFQFDFQRKQEREKQRSQLLKLQSKQ-PGAAELV-------FY 277
            |.::::   |.:.|| .:.|.|:| :| |.:..:..:.|:::.:|:|. ..|.||:       .|
Mouse    16 HTIEMA---SRSRRPEHSGPPELF-YD-QNEARKYVRNSRMIDIQTKMTERALELLCLPEGQPSY 75

  Fly   278 WWDIQLDD--DGEILLSCAPYWA----HPQLKELAAEKAKDHPL-----PNVVPWRDHWMQAIYY 331
            ..||....  .|:.:.....||.    .|.:.:.|.::..:..|     ...||:|.........
Mouse    76 LLDIGCGSGLSGDYISEEGHYWVGIDISPAMLDAALDRDTEGDLLLGDMGQGVPFRPGSFDGCIS 140

  Fly   332 IPKPLQLLEAGKSFHLSCHHDEYSLWFDAREEAPTKSVRRHTCTCDLHMTYSRSRIGQLNQSPRN 396
            |.....|..|.|                 :.:.|.:  |.:.....|:....|.....|...|.|
Mouse   141 ISAVQWLCNANK-----------------KSDVPAR--RLYCFFSSLYSALVRGARAVLQLYPEN 186

  Fly   397 KRYLRYL-----------------EESIEAEKSNVLVLGNGCLLGLASSAL------------GA 432
            ...|..:                 ..|.:|:|..:      ||....|::|            .:
Mouse   187 SEQLELITTQATRAGFTGGVVVDFPNSAKAKKFYL------CLFSGPSTSLPKGLTESQDADQAS 245

  Fly   433 ASVLLHE--PHRFSRRLIESIVKHNQ 456
            .|:...|  ||:.:||   .:||.::
Mouse   246 ESMFTSERAPHKKARR---DLVKKSR 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art7NP_611753.4 AdoMet_MTases 36..>186 CDD:302624
Bud23XP_030110611.1 UbiG 37..>110 CDD:225137 15/73 (21%)
Methyltransf_11 77..>147 CDD:369777 12/69 (17%)
WBS_methylT 223..298 CDD:372208 11/49 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.