DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art7 and Prmt1

DIOPT Version :9

Sequence 1:NP_611753.4 Gene:Art7 / 37664 FlyBaseID:FBgn0034817 Length:690 Species:Drosophila melanogaster
Sequence 2:XP_006229206.1 Gene:Prmt1 / 60421 RGDID:62020 Length:371 Species:Rattus norvegicus


Alignment Length:325 Identity:75/325 - (23%)
Similarity:127/325 - (39%) Gaps:73/325 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DYHLEVANAGFG---DMLHDWERNQKYFAALRKTIAGMREAGREVHVLDIGTGTGILSMMALAAG 86
            ||:.: :.|.||   :||.|..|...|    |.::...|...::..|||:|:|||||.|.|..||
  Rat    51 DYYFD-SYAHFGIHEEMLKDEVRTLTY----RNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAG 110

  Fly    87 ADSVTACEAFLPMANCAEKILAANGAGDKVRLIRKRSTEIQVGEDMPRKANLLVAELLDTELIGE 151
            |..|...|. ..:::.|.||:.||.....|.:|:.:..|:::..:   |.:::::|.:...|..|
  Rat   111 ARKVIGIEC-SSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVE---KVDIIISEWMGYCLFYE 171

  Fly   152 GAIGIYNHAHAELLTEDALCIPARARCYAQVAQSPLAAQWNSLKTIANLDGEPLLHPPEQL---- 212
            ..:....||..:.|..|.|..|.||..|....:.   .|:...|          :|..|.:    
  Rat   172 SMLNTVLHARDKWLAPDGLIFPDRATLYVTAIED---RQYKDYK----------IHWWENVYGFD 223

  Fly   213 KSCQGEAALHDVQLSQLPSSAFRPLTDPVE----------IFQFDFQRKQEREKQRSQLLKLQSK 267
            .||     :.||.:.:       ||.|.|:          |.:.|....:..:...:....||.|
  Rat   224 MSC-----IKDVAIKE-------PLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVK 276

  Fly   268 QPGAAELVFYWWDIQLDDDGEILLSCAPYWAHPQLKELAAEKAKDHPLPNVVPWRDHWMQAIYYI 332
            :......:..:::|:       ...|     |   |......:.:.|.       .||.|.::|:
  Rat   277 RNDYVHALVAYFNIE-------FTRC-----H---KRTGFSTSPESPY-------THWKQTVFYM 319

  Fly   333  332
              Rat   320  319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art7NP_611753.4 AdoMet_MTases 36..>186 CDD:302624 45/152 (30%)
Prmt1XP_006229206.1 AdoMet_MTases 92..192 CDD:100107 33/103 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.