Sequence 1: | NP_611753.4 | Gene: | Art7 / 37664 | FlyBaseID: | FBgn0034817 | Length: | 690 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001076348.1 | Gene: | bud23 / 572367 | ZFINID: | ZDB-GENE-070410-68 | Length: | 282 | Species: | Danio rerio |
Alignment Length: | 195 | Identity: | 39/195 - (20%) |
---|---|---|---|
Similarity: | 67/195 - (34%) | Gaps: | 41/195 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 229 LPSSAFRP-LTDPVEIFQFDFQRKQEREKQRSQLLKLQSK-QPGAAELV-------FYWWDIQLD 284
Fly 285 D--DGEILLSCAPYWAHPQLK----ELAAEKAKDHPL-----PNVVPWRDHWMQAIYYIPKPLQL 338
Fly 339 LEAGKSFHLSCHHDEYSLWFDAREEAPTKSVRRHTCTCDLHMTYSRSRIGQLNQSPRNKRYLRYL 403
Fly 404 403 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Art7 | NP_611753.4 | AdoMet_MTases | 36..>186 | CDD:302624 | |
bud23 | NP_001076348.1 | Methyltransf_11 | 58..133 | CDD:285453 | 13/74 (18%) |
WBS_methylT | 204..280 | CDD:289366 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0500 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |