DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art7 and mettl7a.3

DIOPT Version :9

Sequence 1:NP_611753.4 Gene:Art7 / 37664 FlyBaseID:FBgn0034817 Length:690 Species:Drosophila melanogaster
Sequence 2:NP_001373576.1 Gene:mettl7a.3 / 569046 ZFINID:ZDB-GENE-120215-64 Length:242 Species:Danio rerio


Alignment Length:147 Identity:28/147 - (19%)
Similarity:47/147 - (31%) Gaps:62/147 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   397 KRYLRYLEESIEAEKSNVLVLGNGCLLGLASSALGAASVLLH------------EPHRFSRRLIE 449
            ||.|....|..:..|.::.:|..||         |:.:...|            .|| |...|.:
Zfish    54 KRELFLNLERFQPSKGSLRILEVGC---------GSGANFEHYPTGSKITCTDPNPH-FKTYLEK 108

  Fly   450 SIVKHNQLKNVQFL----DKVEELEDSRLAA--------------------------------LT 478
            |:.|:..|....|:    :.::.:|||.:.|                                |.
Zfish   109 SMEKNEHLVYDSFIVASGENLQAVEDSSVDAVVCTLVLCTVKDTNKVLQEAKRVLRPGGAFFFLE 173

  Fly   479 HIFAEP----YFLNAIL 491
            |:.::|    ||...:|
Zfish   174 HVVSDPSTWAYFFQHVL 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art7NP_611753.4 AdoMet_MTases 36..>186 CDD:302624
mettl7a.3NP_001373576.1 Methyltransf_11 74..171 CDD:400514 17/106 (16%)
AsSugarArsM <132..>222 CDD:411681 10/59 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.