Sequence 1: | NP_611753.4 | Gene: | Art7 / 37664 | FlyBaseID: | FBgn0034817 | Length: | 690 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009290865.1 | Gene: | alkbh8 / 556362 | ZFINID: | ZDB-GENE-100922-251 | Length: | 666 | Species: | Danio rerio |
Alignment Length: | 200 | Identity: | 41/200 - (20%) |
---|---|---|---|
Similarity: | 70/200 - (35%) | Gaps: | 72/200 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 148 LIGEGAI--GIYNHAHAELLTE----DALCIPARARCYAQVAQSPLAAQWNSLKTIANLDGEPLL 206
Fly 207 HPPEQLKSCQGEAALHDVQLSQLPSSAFRPLTDPVEIFQFDFQRKQEREKQRSQLLKLQSKQPGA 271
Fly 272 AELVFYWWDIQLDDDGEILLSCAPYWAHPQLKELAAEKA---------------------KDHPL 315
Fly 316 PNVVP 320 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Art7 | NP_611753.4 | AdoMet_MTases | 36..>186 | CDD:302624 | 10/43 (23%) |
alkbh8 | XP_009290865.1 | RRM_ALKBH8 | 40..119 | CDD:240877 | 20/108 (19%) |
2OG-FeII_Oxy | 130..300 | CDD:304390 | 18/79 (23%) | ||
Methyltransf_11 | 409..498 | CDD:285453 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0500 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |