DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art7 and alkbh8

DIOPT Version :9

Sequence 1:NP_611753.4 Gene:Art7 / 37664 FlyBaseID:FBgn0034817 Length:690 Species:Drosophila melanogaster
Sequence 2:XP_009290865.1 Gene:alkbh8 / 556362 ZFINID:ZDB-GENE-100922-251 Length:666 Species:Danio rerio


Alignment Length:200 Identity:41/200 - (20%)
Similarity:70/200 - (35%) Gaps:72/200 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 LIGEGAI--GIYNHAHAELLTE----DALCIPARARCYAQVAQSPLAAQWNSLKTIANLDGEPLL 206
            ::..|.:  |:...:..|:|.|    ::|..|. ::.||.|:.|.:.|..|:...   |:|..| 
Zfish    44 VVSNGGLGNGVSRESLLEVLKEGGTVESLLTPP-SKPYAFVSYSSIEAGQNAYTL---LNGRTL- 103

  Fly   207 HPPEQLKSCQGEAALHDVQLSQLPSSAFRPLTDPVEIFQFDFQRKQEREKQRSQLLKLQSKQPGA 271
                   .||                      |......|.:..|.:.::..|..|     .||.
Zfish   104 -------QCQ----------------------DQTMTLYFSYVVKVDCDRSVSCAL-----PPGL 134

  Fly   272 AELVFYWWDIQLDDDGEILLSCAPYWAHPQLKELAAEKA---------------------KDHPL 315
            :.|..:   :.|:::.:||.  |..|. |...::.|:||                     ||.||
Zfish   135 SVLEDF---VSLEEELQILK--AVDWT-PHADDVTAQKALKHRRVKHYGYEFRYDNNNVDKDKPL 193

  Fly   316 PNVVP 320
            |..:|
Zfish   194 PGGLP 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art7NP_611753.4 AdoMet_MTases 36..>186 CDD:302624 10/43 (23%)
alkbh8XP_009290865.1 RRM_ALKBH8 40..119 CDD:240877 20/108 (19%)
2OG-FeII_Oxy 130..300 CDD:304390 18/79 (23%)
Methyltransf_11 409..498 CDD:285453
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.