DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art7 and zgc:162780

DIOPT Version :9

Sequence 1:NP_611753.4 Gene:Art7 / 37664 FlyBaseID:FBgn0034817 Length:690 Species:Drosophila melanogaster
Sequence 2:NP_001038249.1 Gene:zgc:162780 / 555377 ZFINID:ZDB-GENE-070410-92 Length:274 Species:Danio rerio


Alignment Length:309 Identity:76/309 - (24%)
Similarity:113/309 - (36%) Gaps:100/309 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   383 SRSRIGQLNQSPRNKRYLRYLEESIEAEKSNVLVLGNGCLLGLASSALGAASVLLHEPHRFSRRL 447
            |...||::.|..||..|           .||.|.:..||..|        ...||..|| |:|.:
Zfish    23 SEELIGKVLQFHRNNEY-----------SSNGLAVDVGCGSG--------QGTLLLAPH-FTRVV 67

  Fly   448 --------IESIVKHNQLKNVQFLDK-VEEL--EDSRLAALTHIFAEPYFLNAILPWDNFYFGTL 501
                    :|...||..:.||.|.:. .|||  ||..:..:|.:.|..:|       |:..|   
Zfish    68 GTDISPAQLEMGRKHVNIPNVSFRESPAEELPFEDGSVDLVTAMSAFHWF-------DHSRF--- 122

  Fly   502 LTKIKDRL--PEGVKISPCSARI-YALPVE-----------------FLDLHKIRAPVGSCEGFD 546
             .:..||:  |.|     |.|.: |.|.:|                 :..||.:|.|......|:
Zfish   123 -LQEADRVLKPHG-----CLALLNYTLDMELTYGNCSEALNLICNEFYAALHPLRDPHLGPSSFE 181

  Fly   547 L--RLFDEMVERSAE--QAVSLVEAQPLWEY--PCRALSEPQEVLSVDFSNFGQEHSLKGSIELK 605
            |  |.:|.:.....|  ....:.:|.||..|  ..::.|..|.:|..|     .|.:.:.|    
Zfish   182 LYKRTYDSLQYPVKEWHDLFWVKKAVPLSGYIGMVKSFSTFQTLLKTD-----PEEARRLS---- 237

  Fly   606 HPRICNGVALWVDWQLVEDNSPRSI-VSSGPSEPVVPGEFVKWDMFVRQ 653
                          |.:||...|:: |:|..:| |:.|  ||:..|:.|
Zfish   238 --------------QGIEDRLKRAMDVTSSETE-VIMG--VKYFYFLAQ 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art7NP_611753.4 AdoMet_MTases 36..>186 CDD:302624
zgc:162780NP_001038249.1 Methyltransf_11 46..138 CDD:285453 30/116 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.