DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art7 and PRMT6

DIOPT Version :9

Sequence 1:NP_611753.4 Gene:Art7 / 37664 FlyBaseID:FBgn0034817 Length:690 Species:Drosophila melanogaster
Sequence 2:NP_060607.2 Gene:PRMT6 / 55170 HGNCID:18241 Length:375 Species:Homo sapiens


Alignment Length:357 Identity:75/357 - (21%)
Similarity:125/357 - (35%) Gaps:139/357 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DMLHDWERNQKYFAALRKTIAGMREAGREVHVLDIGTGTGILSMMALAAGADSVTACEAFLPMAN 101
            :|:.|..|...|...:.:..|.:|  |:.  |||:|.||||||:....|||..|.|.|| ..:..
Human    59 EMIADRVRTDAYRLGILRNWAALR--GKT--VLDVGAGTGILSIFCAQAGARRVYAVEA-SAIWQ 118

  Fly   102 CAEKILAANGAGDKVRLIRKRSTEIQVGEDMPRKANLLVAELLDTELIGEGAIGIYNHAHAELLT 166
            .|.:::..||..|:|.::......:    ::|.:.:.:|:|.:...|:.|..:....||..:.|.
Human   119 QAREVVRFNGLEDRVHVLPGPVETV----ELPEQVDAIVSEWMGYGLLHESMLSSVLHARTKWLK 179

  Fly   167 EDALCIPARARCYAQVAQSPLAAQ--------WNSLK------------------------TIAN 199
            |..|.:||.|..:.    :|::.|        |:.:|                        .:..
Human   180 EGGLLLPASAELFI----APISDQMLEWRLGFWSQVKQHYGVDMSCLEGFATRCLMGHSEIVVQG 240

  Fly   200 LDGEPLLHPPE---QLK--------------------SCQGEAALHDVQLSQLPSSAFRPLTDPV 241
            |.||.:|..|:   ||:                    ||.|.|.:|...:               
Human   241 LSGEDVLARPQRFAQLELSRAGLEQELEAGVGGRFRCSCYGSAPMHGFAI--------------- 290

  Fly   242 EIFQFDFQRKQEREKQRSQLLKLQSKQPGAAELVFYWWDIQLDDDGEILLSCAPYWAHPQLKELA 306
             .||..|                    ||.            :.:..::||.:|:          
Human   291 -WFQVTF--------------------PGG------------ESEKPLVLSTSPF---------- 312

  Fly   307 AEKAKDHPLPNVVPWRDHWMQAIYYIPKPLQL 338
                  ||       ..||.||:.|:.:|:|:
Human   313 ------HP-------ATHWKQALLYLNEPVQV 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art7NP_611753.4 AdoMet_MTases 36..>186 CDD:302624 42/148 (28%)
PRMT6NP_060607.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38
AdoMet_MTases 67..>200 CDD:418430 40/145 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.