DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art7 and prmt3

DIOPT Version :9

Sequence 1:NP_611753.4 Gene:Art7 / 37664 FlyBaseID:FBgn0034817 Length:690 Species:Drosophila melanogaster
Sequence 2:NP_001017655.1 Gene:prmt3 / 550348 ZFINID:ZDB-GENE-041105-1 Length:512 Species:Danio rerio


Alignment Length:378 Identity:80/378 - (21%)
Similarity:136/378 - (35%) Gaps:97/378 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 YDYHLEVANAGFGDMLHDWERNQKYFAALRKTIAGMREAGREVHVLDIGTGTGILSMMALAAGAD 88
            |..|.|        ||.|..|.:.|    |..:....:..::..|||:|.|||||||.|..|||.
Zfish   208 YSIHEE--------MLKDKVRTESY----RDFMYRNMDVFKDKVVLDVGCGTGILSMFAAKAGAK 260

  Fly    89 SVTACEAFLPMANCAEKILAANGAGDKVRLIRKRSTEIQVGEDMP-RKANLLVAELLDTELIGEG 152
            .|.|.:. ..:...|..|:.:|...|.:.||:.|..||    |:| .|.:::::|.:...|:...
Zfish   261 KVVAVDQ-SEIIYQAMDIVRSNNLEDTITLIKGRIEEI----DLPVEKVDIIISEWMGYFLLFGS 320

  Fly   153 AIGIYNHAHAELLTEDALCIPARARCYAQVA-------QSPLAAQWNSLKTIANLDGEPLLHPPE 210
            .:....:|....|.:|.|..|  .||...:|       .:...|.|..:........:..:.|..
Zfish   321 MLDSVLYARDRYLADDGLVFP--DRCSISLAAVGDTQKHNDRIAFWEDVYGFKMTCMKKAVIPEA 383

  Fly   211 QLKSCQGEAALHD-----------VQLSQLPSSAFRPLTDPVEIFQFDFQRKQEREKQRSQLLKL 264
            .::..:.|..:.:           |.:|:|.             |..||            :||:
Zfish   384 VVEVLKPETVISESAVIKTIDCGSVSVSELE-------------FSVDF------------ILKI 423

  Fly   265 QSKQPGAAELVFYWWDIQLDDD--GEILLSCAPYWAHPQLKELAAEKAKDHPLPNVVPWRDHWMQ 327
            .:.....|  :..::||.....  .:::.|.||...                       :.||.|
Zfish   424 TASSFCTA--IVGYFDIFFHKSCGNKVMFSTAPNCT-----------------------KTHWKQ 463

  Fly   328 AIYYIPKPLQLLEAGKSF--HLSCHHDEYSLWFDAREEAPTKSVRRHTCTCDL 378
            .::.:..|: .::||:..  |:|...:..    |.|....|.::..|..|..|
Zfish   464 TVFLLESPV-AVKAGEDLPGHISVRKNRK----DPRALLITLNIAGHKQTYSL 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art7NP_611753.4 AdoMet_MTases 36..>186 CDD:302624 45/157 (29%)
prmt3NP_001017655.1 zf-C2H2_2 39..>86 CDD:289522
Methyltransf_18 236..340 CDD:289607 35/108 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.