DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art7 and Art6

DIOPT Version :9

Sequence 1:NP_611753.4 Gene:Art7 / 37664 FlyBaseID:FBgn0034817 Length:690 Species:Drosophila melanogaster
Sequence 2:NP_650322.1 Gene:Art6 / 41699 FlyBaseID:FBgn0038189 Length:341 Species:Drosophila melanogaster


Alignment Length:345 Identity:81/345 - (23%)
Similarity:141/345 - (40%) Gaps:95/345 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GDDYDY---------HLEVANAGFGDMLHDWERNQKYFAALRKTIAGMREAG--REVHVLDIGTG 74
            |.|.||         |:        :||.|..|.|.:..|:      :::.|  ::..|||:|.|
  Fly    14 GKDSDYFQSYSRLETHM--------NMLRDSVRMQAFRDAI------VQDGGLFQDKIVLDVGCG 64

  Fly    75 TGILSMMALAAGADSVTACEAFLPMANCAEKILAANGAGDKVRLIRKRSTEIQVGEDMPRKANLL 139
            |||||:.|..|||..|.|.|. ..:|:.||:|:..|...:.|::::....::::.:.: .|.:::
  Fly    65 TGILSLFAAEAGASKVIAVEC-TDIADIAEEIIRDNQKENVVKVVKGLVEQVELPDGI-EKVDII 127

  Fly   140 VAELLDTELIGEGAIGIYNHAHAELLTEDALCIPARARCYAQVAQSPLAAQWNSLKTIANLDG-- 202
            |:|.:...|..|..|.....|..:.||.....:|:....:...|..|  .:..:|....|::|  
  Fly   128 VSEWMGNALYMEAMINSVLFARDKWLTRGGRILPSTGNLWLMGAYDP--HRRTNLNFWCNVEGID 190

  Fly   203 ----------EPLLH--PPEQLKSCQGEAALHDVQLSQLPSSAFRPLTDPVEIFQFDFQRKQERE 255
                      |||:.  |.:||.:  .|..:|...|:...:       .||| ||.:||.|..| 
  Fly   191 MGCVRKPFSQEPLVEFVPIQQLLT--DECFIHSTNLAVARN-------QPVE-FQSNFQLKVMR- 244

  Fly   256 KQRSQLLKLQSKQPGAAELVFYWWDIQLDDDGE----ILLSCAPYWAHPQLKELAAEKAKDHPLP 316
                         .|...::..::|: |...|:    :.|:.:|:                    
  Fly   245 -------------TGIINMLVLYFDV-LFPSGKSNKSVSLTTSPH-------------------- 275

  Fly   317 NVVPWRDHWMQAIYYIPKPL 336
              .|| .||.|.:.::.:||
  Fly   276 --SPW-THWEQTVLHLDEPL 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art7NP_611753.4 AdoMet_MTases 36..>186 CDD:302624 41/151 (27%)
Art6NP_650322.1 AdoMet_MTases 29..>161 CDD:302624 40/147 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440112
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11006
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.