DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art7 and Art9

DIOPT Version :9

Sequence 1:NP_611753.4 Gene:Art7 / 37664 FlyBaseID:FBgn0034817 Length:690 Species:Drosophila melanogaster
Sequence 2:NP_650321.1 Gene:Art9 / 41698 FlyBaseID:FBgn0038188 Length:313 Species:Drosophila melanogaster


Alignment Length:314 Identity:63/314 - (20%)
Similarity:107/314 - (34%) Gaps:107/314 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EVANAGFGDML----HDW--ERNQKYFAALRKTIAGMREAGREVHVLDIGTGTGILSMMALAAGA 87
            |:|::...|::    ::|  :|.::.|              ::..|||:|..:|:||:|::.|||
  Fly    10 EMADSMLNDVISTRAYEWVFKRYERLF--------------KDKIVLDVGCRSGLLSLMSVEAGA 60

  Fly    88 DSVTAC------------------------------EAFLPMANCAEKILAANGAGDKV------ 116
            ..|.|.                              |..||.......|:.:...|..|      
  Fly    61 VKVMALGNRESAEFVSKAFIGTEKEDIFEFIDGDIHEIVLPCGLKKVDIIVSEWVGHSVFVDSLF 125

  Fly   117 --RLIRKRSTEIQVGEDMPRKANLLVAELLDTELIGEGAIGIYNHAHAELLTEDALCIPAR---A 176
              .:..:....::.|..:|..|.|.|.             ||.:|...   |.:...:|..   .
  Fly   126 KEVIFAREKWLVKGGFIIPNVAQLFVC-------------GIADHPRK---TVEVNILPQSDYPG 174

  Fly   177 RCYA----------QVAQSPLAAQWNSLKTI----ANLDGEPLLHPPEQLKSCQ----GEAALH- 222
            |.|.          .||:..|..:...||||    |:::.|. ...|.:|:..:    |...|: 
  Fly   175 RSYMVREPVSLIEDYVAKEQLITEKYLLKTIDLCTAHINDES-FRVPFKLRGLRDSQLGAVVLYS 238

  Fly   223 DVQLSQLPSSAFRPLTDPVEIFQFDFQRKQEREKQRSQLLKLQSK-QPGAAELV 275
            |:.|.: |...||        ..|....|:.|...|..:|.:.:. :....|||
  Fly   239 DIGLCR-PRGKFR--------LMFSTGPKRPRTYVRQTILFMDNPVEVAKCELV 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art7NP_611753.4 AdoMet_MTases 36..>186 CDD:302624 37/206 (18%)
Art9NP_650321.1 AdoMet_MTases 41..143 CDD:100107 20/101 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440110
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11006
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.