DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art7 and Prmt8

DIOPT Version :9

Sequence 1:NP_611753.4 Gene:Art7 / 37664 FlyBaseID:FBgn0034817 Length:690 Species:Drosophila melanogaster
Sequence 2:NP_958759.2 Gene:Prmt8 / 381813 MGIID:3043083 Length:394 Species:Mus musculus


Alignment Length:420 Identity:90/420 - (21%)
Similarity:158/420 - (37%) Gaps:104/420 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SC-----FSHVMNPITGQNSWQERGDDYDYHLEVANAGFG---DMLHDWERNQKYFAALRKTIAG 58
            ||     .|.::||        |.....||:.: :.|.||   :||.|..|...|    |.::..
Mouse    54 SCPGRGKMSKLLNP--------EEMTSRDYYFD-SYAHFGIHEEMLKDEVRTLTY----RNSMYH 105

  Fly    59 MREAGREVHVLDIGTGTGILSMMALAAGADSVTACEAFLPMANCAEKILAANGAGDKVRLIRKRS 123
            .:...::..|||:|:|||||||.|..|||..|...|. ..:::.:|||:.||...:.:.:.:.:.
Mouse   106 NKHVFKDKVVLDVGSGTGILSMFAAKAGAKKVFGIEC-SSISDYSEKIIKANHLDNVITIFKGKV 169

  Fly   124 TEIQVGEDMPRKANLLVAELLDTELIGEGAIGIYNHAHAELLTEDALCIPARARCYAQVAQSPLA 188
            .|:::..:   |.:::::|.:...|..|..:.....|..:.|....|..|.||..|....:.   
Mouse   170 EEVELPVE---KVDIIISEWMGYCLFYESMLNTVIFARDKWLKPGGLMFPDRAALYVVAIED--- 228

  Fly   189 AQWNSLKTIANLDGEPLLHPPEQL----KSCQGEAALHDVQLSQLPSSAFRPLTDPVE------- 242
            .|:...|          :|..|.:    .:|     :.||.:.:       ||.|.|:       
Mouse   229 RQYKDFK----------IHWWENVYGFDMTC-----IRDVAMKE-------PLVDIVDPKQVVTN 271

  Fly   243 ---IFQFDFQRKQEREKQRSQLLKLQSKQPGAAELVFYWWDIQLDDDGEILLSCAPYWAHPQLKE 304
               |.:.|....:..|...:....||.::......:..:::|:       ...|     |   |:
Mouse   272 ACLIKEVDIYTVKTEELSFTSAFCLQIQRNDYVHALVTYFNIE-------FTKC-----H---KK 321

  Fly   305 LAAEKAKDHPLPNVVPWRDHWMQAIYYIPKPLQLLEAGKSFHLSCHHDEYSLWFDAREEAPTKSV 369
            :....|.|.|.       .||.|.::|:..           :|:....| .::.....:...|:|
Mouse   322 MGFSTAPDAPY-------THWKQTVFYLED-----------YLTVRRGE-EIYGTISMKPNAKNV 367

  Fly   370 RRHTCTCDLHMTYSRSRIGQLNQSPRNKRY 399
            |      ||..|......|||.::..:..|
Mouse   368 R------DLDFTVDLDFKGQLCETSVSNDY 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art7NP_611753.4 AdoMet_MTases 36..>186 CDD:302624 41/152 (27%)
Prmt8NP_958759.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..40
SH3-binding 1. /evidence=ECO:0000250|UniProtKB:Q9NR22 29..42
SH3-binding 2. /evidence=ECO:0000250|UniProtKB:Q9NR22 53..58 2/3 (67%)
AdoMet_MTases 115..215 CDD:100107 30/103 (29%)
S-adenosyl-L-methionine binding. /evidence=ECO:0000250|UniProtKB:Q9NR22 119..122 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.