DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art7 and CG17807

DIOPT Version :9

Sequence 1:NP_611753.4 Gene:Art7 / 37664 FlyBaseID:FBgn0034817 Length:690 Species:Drosophila melanogaster
Sequence 2:NP_611690.2 Gene:CG17807 / 37585 FlyBaseID:FBgn0034748 Length:615 Species:Drosophila melanogaster


Alignment Length:290 Identity:45/290 - (15%)
Similarity:80/290 - (27%) Gaps:143/290 - (49%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 VLDIGTGTGILSMMALAAGADSVTACEAFLPMANC--AEKILAANGAGDKVRLIRKRSTEIQVGE 130
            |||||.|.|            ...:|...|....|  |:.:||..         |::      |:
  Fly   399 VLDIGCGNG------------KYLSCNPLLLSVGCDRAQGLLAVG---------RRK------GQ 436

  Fly   131 DMPRKANLLVAELLDTELIGEGAIGIYNHAHAELLTEDALCIPARARCYAQVAQSPLAAQWNSLK 195
            ::.|.                                |.|.:|.|:                   
  Fly   437 NVFRC--------------------------------DCLVVPVRS------------------- 450

  Fly   196 TIANLDGEPLLHPPEQLKSCQGEAALHDVQLSQLPSSAFRPLTDPVEIFQFDFQRKQEREKQRSQ 260
              :::||            |...|.:|.:...                     :|:....::.::
  Fly   451 --SSIDG------------CISIAVIHHLATK---------------------ERRLAALQEMAR 480

  Fly   261 LLKLQSKQPGAAELVFYWWDIQLDDDGEILL-----------SCAPYWAHPQLKELAAEKAKDHP 314
            :|:     ||...||:.|...|..:|.:...           :........|.:||..:.:.::|
  Fly   481 VLR-----PGGRALVYVWAKDQRKNDKKSTYLRQNKAVNKERTTEQQQRQKQHQELEQQLSNNNP 540

  Fly   315 LP------------NVVPWRDHWMQAIYYI 332
            ||            .:|||:....|...|:
  Fly   541 LPVHTNRTEFQQQDVLVPWKTKDEQKTTYL 570

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art7NP_611753.4 AdoMet_MTases 36..>186 CDD:302624 20/119 (17%)
CG17807NP_611690.2 RRM_ALKBH8 40..119 CDD:240877
2OG-FeII_Oxy 136..322 CDD:304390
Methyltransf_11 400..490 CDD:285453 28/207 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.