DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art7 and Bud23

DIOPT Version :9

Sequence 1:NP_611753.4 Gene:Art7 / 37664 FlyBaseID:FBgn0034817 Length:690 Species:Drosophila melanogaster
Sequence 2:NP_001129215.1 Gene:Bud23 / 368084 RGDID:1589742 Length:281 Species:Rattus norvegicus


Alignment Length:234 Identity:52/234 - (22%)
Similarity:84/234 - (35%) Gaps:59/234 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 GREVHVLDIGTGTGI----------------LSMMALAAGADSVTACEAFLPMANCAEKILAANG 111
            |:..::||||.|:|:                :|...|.|..|..|  |..|.:.:..:.:....|
  Rat    52 GQPSYLLDIGCGSGLSGDYISEEGHYWVGIDISPAMLDAALDRDT--EGDLLLGDMGQGVPFRPG 114

  Fly   112 AGDKVRLI---------RKRSTEIQVGEDMP-RKANLLVAELLDTELIGEGAI-GIY--NHAHAE 163
            :.|....|         .|:|       |:| |:.....:.|....:.|..|: .:|  |....|
  Rat   115 SFDGCISISAVQWLCNANKKS-------DIPARRLYCFFSSLYSALVRGARAVLQLYPENSEQLE 172

  Fly   164 LLTEDALCIPARAR-CYAQVAQSPLAAQWNSLKTIANLDGEPLLHPPEQLKSCQGEAALHDVQLS 227
            |:|..|    .||. ....|...|.:|:  :.|....|...|....|:.|...|        :..
  Rat   173 LITTQA----TRAGFTGGVVVDFPNSAK--AKKFYLCLFSGPSTSLPKGLTESQ--------EAD 223

  Fly   228 QLPSSAFRPLTDPVEIFQFDFQRK------QEREKQRSQ 260
            |...|||.....|.:..:.|..:|      :::|::|.|
  Rat   224 QASESAFTSERAPHKKARRDLVKKSREWVLEKKERRRRQ 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art7NP_611753.4 AdoMet_MTases 36..>186 CDD:302624 34/152 (22%)
Bud23NP_001129215.1 UbiG 18..>91 CDD:225137 9/38 (24%)
Methyltransf_11 58..>128 CDD:400514 16/71 (23%)
WBS_methylT 204..279 CDD:403702 15/67 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.