DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art7 and CG8067

DIOPT Version :9

Sequence 1:NP_611753.4 Gene:Art7 / 37664 FlyBaseID:FBgn0034817 Length:690 Species:Drosophila melanogaster
Sequence 2:NP_001260960.1 Gene:CG8067 / 36552 FlyBaseID:FBgn0033891 Length:333 Species:Drosophila melanogaster


Alignment Length:352 Identity:68/352 - (19%)
Similarity:121/352 - (34%) Gaps:128/352 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 HDWERN----QKYFAALRKTIA---------GMREAGREVHV-------LDIGTGTGILSMMALA 84
            |.::||    ||..|||.:.:.         |.|.|.|...:       .|||...|.||...||
  Fly    29 HIFDRNAKRLQKERAALSEDVGLYDYLKEEIGFRLADRVFDIKREFKAAADIGCSRGYLSRHILA 93

  Fly    85 AGADSVTACEAFLPMANCAEKILAANGAGDKVRLIRKRSTEIQVGEDMPRKANLLVAELLDTELI 149
            ...:.:|..:.   .|...|:.....|    :::::....|.|:  |....:..||...|....:
  Fly    94 ESVEQLTLTDT---SATMLEQAQGTPG----LKMVKLVKDEEQL--DFEDNSLDLVISSLSLHWV 149

  Fly   150 GEGAIGIYNHAHAELLTEDALCIPARARCYAQVAQSPLAAQWNSLKT----IANLDGEPLLHPPE 210
            .:                    :|.   |:.::.|        |||.    ||::.|...|:   
  Fly   150 ND--------------------LPG---CFVRIKQ--------SLKPDGVFIASMFGGDTLY--- 180

  Fly   211 QLKSCQGEAALHDVQLSQLP-----SSAFRPLTDPVEIFQFDFQRKQEREKQRSQLLKLQSKQ-- 268
            :|:|        .:||::|.     |....|.|...:|...       ..:....:|.:.:.:  
  Fly   181 ELRS--------SLQLAELERKGGISPHISPFTQIRDIGSL-------LNRAGFTMLTIDTDELV 230

  Fly   269 ---PGAAELVFYWWDIQ--LDDDG----------EILLSCAPYWAHPQLKELAAEKAKDHPLPNV 318
               |...||:   ||::  .:::.          |.:|:.:..:     :||.| |..:..:|..
  Fly   231 IGYPSMFELM---WDLKGMAENNAAFNRPAHLSRETMLAASAIY-----QELYA-KPNEKGIPAT 286

  Fly   319 VPWRDHWMQAIYYI--------PKPLQ 337
                   .|.||::        |:||:
  Fly   287 -------FQIIYFVGWKPGPNQPQPLE 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art7NP_611753.4 AdoMet_MTases 36..>186 CDD:302624 33/165 (20%)
CG8067NP_001260960.1 BioC 58..296 CDD:273953 57/311 (18%)
Methyltransf_11 79..170 CDD:285453 24/130 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.