DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art7 and CG10428

DIOPT Version :9

Sequence 1:NP_611753.4 Gene:Art7 / 37664 FlyBaseID:FBgn0034817 Length:690 Species:Drosophila melanogaster
Sequence 2:NP_609918.1 Gene:CG10428 / 35150 FlyBaseID:FBgn0032724 Length:585 Species:Drosophila melanogaster


Alignment Length:178 Identity:39/178 - (21%)
Similarity:64/178 - (35%) Gaps:51/178 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 FGDMLHDW------------------ERNQKYFAALRKTIAGMREAGREVHVLDIGTGTGILSMM 81
            :|..|.||                  ||.::....|...:..:.:.|.  .::|..:|||.|:::
  Fly   341 YGQQLIDWEQIEPTHAKSSALPKERLERKRQQLENLANAVVSLAQPGD--RIVDFCSGTGHLAIL 403

  Fly    82 ALAAGADSVTACEAFLPMANCAEKILAANGAGDKVRLIRKRSTEIQVGEDMPRKANLLVAELLDT 146
             ||....:.|    .:.|.|.|..:|.|          :|||.|:.:...:..:.|:       .
  Fly   404 -LALKLPNCT----IIVMENKAFSLLQA----------QKRSNELGLTNCVFYQCNI-------D 446

  Fly   147 ELIGEGAIGIYNHAHAELLTEDAL--CIPARAR------CYAQVAQSP 186
            ..:|...||...|| ....|:..|  |..|:|.      ||..:...|
  Fly   447 YFVGGFKIGASLHA-CGTATDIVLQQCRRAKAHFVCCPCCYGSLQPMP 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art7NP_611753.4 AdoMet_MTases 36..>186 CDD:302624 38/175 (22%)
CG10428NP_609918.1 GST_C_family <212..258 CDD:198286
AdoMet_MTases 368..486 CDD:302624 31/142 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.