DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art7 and prmt1

DIOPT Version :9

Sequence 1:NP_611753.4 Gene:Art7 / 37664 FlyBaseID:FBgn0034817 Length:690 Species:Drosophila melanogaster
Sequence 2:NP_956944.2 Gene:prmt1 / 321974 ZFINID:ZDB-GENE-030131-693 Length:348 Species:Danio rerio


Alignment Length:280 Identity:69/280 - (24%)
Similarity:116/280 - (41%) Gaps:55/280 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GQNSWQERGDDY---DYHLEVANAGFG---DMLHDWERNQKYFAALRKTIAGMREAGREVHVLDI 71
            |::|.:...:|.   ||:.: :.|.||   :||.|..|...|    |.::...:...::..|||:
Zfish    13 GESSAKPAAEDMTSKDYYFD-SYAHFGIHEEMLKDEVRTLTY----RNSMFHNKHLFKDKVVLDV 72

  Fly    72 GTGTGILSMMALAAGADSVTACEAFLPMANCAEKILAANGAGDKVRLIRKRSTEIQVGEDMPRKA 136
            |:|||||.|.|..|||..|...|. ..:::.|.||:.||.....|.:|:.:..|:::..:   ..
Zfish    73 GSGTGILCMFAAKAGAKKVIGIEC-SSISDYAVKIVKANKLDHIVTIIKGKVEEVELPVE---NV 133

  Fly   137 NLLVAELLDTELIGEGAIGIYNHAHAELLTEDALCIPARARCYAQVAQ----SPLAAQW------ 191
            :::::|.:...|..|..:....:|..:.|..|.|..|.||..|....:    ......|      
Zfish   134 DIIISEWMGYCLFYESMLNTVIYARDKWLKPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYG 198

  Fly   192 ---NSLKTIANLDGEPLLH--PPEQLKSCQ---GEAALHDVQLSQLPSSAFRPLTDP-------- 240
               :.:|.:|..  |||:.  .|:||.|..   .|..::.|::..|      ..|.|        
Zfish   199 FDMSCIKEVAIT--EPLVDVVDPKQLVSTACLIKEVDIYTVKIEDL------SFTSPFCLQVKRN 255

  Fly   241 ------VEIFQFDFQRKQER 254
                  |..|..:|.|..:|
Zfish   256 DYIHALVTYFNIEFTRCHKR 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art7NP_611753.4 AdoMet_MTases 36..>186 CDD:302624 42/156 (27%)
prmt1NP_956944.2 Methyltransf_18 65..169 CDD:289607 31/107 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.