DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art7 and CG32152

DIOPT Version :9

Sequence 1:NP_611753.4 Gene:Art7 / 37664 FlyBaseID:FBgn0034817 Length:690 Species:Drosophila melanogaster
Sequence 2:NP_001287079.2 Gene:CG32152 / 317885 FlyBaseID:FBgn0052152 Length:527 Species:Drosophila melanogaster


Alignment Length:324 Identity:54/324 - (16%)
Similarity:123/324 - (37%) Gaps:67/324 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DMLHDWERNQKYFAALRKTIAGMREAGREVHVLDIGTGTGILSMMALAAGADSVTACEAFLPMAN 101
            |::.:.:::|.:....:..|...|...::..:|.:..|||.|::||...||..|.|.: :..:..
  Fly   185 DVMRNRQKDQAHMYFFQSVIHHQRHLIKDRTILVLCCGTGTLALMAAQMGAKRVYAVD-YSKVTG 248

  Fly   102 CAEKILAANGAGDKVRLIRKRSTEIQVGEDMPRKANLLVAELLDTELIGEGAIGIYNHAHAELLT 166
            ....::..||....:.::..|..:::    :|.|.:.::...:...|:.|..|.....|....|.
  Fly   249 YTTLVVRQNGYEGVITVMNGRMKDLK----LPTKVDGIICNWMGYCLLYESEILEVLEARDRWLK 309

  Fly   167 EDALCIPARARCYAQVAQSPLAAQWNSLKTIANLDGEPLLHPPEQLKSCQGEAALHDVQLSQLPS 231
            :....:|..|..|.      :|::.:.||:                :.|.....::...::.:..
  Fly   310 KGGFILPDLAALYL------VASEEHKLKS----------------ERCNHWRNVYGFNMNAIRR 352

  Fly   232 SAFRPLTDPVE--------------IFQFDFQRKQEREKQRSQLLKLQSKQPGAAELVFYWWDIQ 282
            .|   |.:|..              :.:.|.:|.:..:....:.::|...:.|..|....::::|
  Fly   353 YA---LAEPCVALTTGKKLLTMAHCVLRLDLKRARREDLFIDRNIRLSVNREGYLECFLLFFEVQ 414

  Fly   283 LDDDGEILLSCAPYWAHPQLKELAAEKAKDHPLPNVVPWRDHWMQAIYYIPKPLQLLEAGKSFH 346
            ..:.....|||     :|.||.               |::..|||::.::.:|..:   .|:.|
  Fly   415 FSNSLNFKLSC-----NPCLKS---------------PFKSLWMQSVLFVEQPFVM---RKNIH 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art7NP_611753.4 AdoMet_MTases 36..>186 CDD:302624 28/148 (19%)
CG32152NP_001287079.2 AdoMet_MTases 215..315 CDD:100107 21/104 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440111
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11006
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.