DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art7 and Ndufaf5

DIOPT Version :9

Sequence 1:NP_611753.4 Gene:Art7 / 37664 FlyBaseID:FBgn0034817 Length:690 Species:Drosophila melanogaster
Sequence 2:NP_001119843.1 Gene:Ndufaf5 / 296190 RGDID:1309829 Length:343 Species:Rattus norvegicus


Alignment Length:204 Identity:46/204 - (22%)
Similarity:68/204 - (33%) Gaps:80/204 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 GEAALHDVQLSQLPSSAFRPLTDPVEIFQFDFQRKQER------EKQRSQLLKLQSKQPGA--AE 273
            |......|..|..||.:..|..  :.||..:.:|||:.      |..:...||   ::.|:  |:
  Rat    22 GRGGRRGVASSVPPSGSTSPRA--LNIFDRELKRKQKNWAARQPEPMKFDYLK---EEIGSRIAD 81

  Fly   274 LVFYWWDIQLDDDGEILLSCA-PYWAHPQLKELA--------AEKA------KDHPLPNV----- 318
            .|:   ||..|....:.:.|. .|.|....||..        ||.|      .|.|..|:     
  Rat    82 RVY---DIARDFPLALDIGCGRGYIAQHLNKETVGKIFQTDIAEHALKNSIETDIPTVNILADEE 143

  Fly   319 -VPWRD------------HW-------MQAIYYIPKP--------------------LQLL---- 339
             :|:.:            ||       ::.|:|:.||                    |||.    
  Rat   144 FLPFPENTFDLVVSSLSLHWVNDLPRALEQIHYVLKPDGVFVGAMFGGDTLYELRCSLQLAETER 208

  Fly   340 EAGKSFHLS 348
            |.|.|.|:|
  Rat   209 EGGFSPHIS 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art7NP_611753.4 AdoMet_MTases 36..>186 CDD:302624
Ndufaf5NP_001119843.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..40 5/17 (29%)
BioC 74..310 CDD:273953 32/147 (22%)
Methyltransf_11 94..185 CDD:285453 18/90 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.