powered by:
Protein Alignment Art7 and Antkmt
DIOPT Version :9
Sequence 1: | NP_611753.4 |
Gene: | Art7 / 37664 |
FlyBaseID: | FBgn0034817 |
Length: | 690 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001120919.1 |
Gene: | Antkmt / 287150 |
RGDID: | 1306126 |
Length: | 222 |
Species: | Rattus norvegicus |
Alignment Length: | 49 |
Identity: | 12/49 - (24%) |
Similarity: | 20/49 - (40%) |
Gaps: | 13/49 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 574 PCRALSEPQEVLSVDFSNFGQEHSLKGSIELKHPRICNGVALWVDWQLV 622
|..||:|.:| ...|.:||......:|:|::..|.|:
Rat 6 PAEALTELRE-------------KRLGLLELLQAAAGSGLAVYTVWALL 41
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Art7 | NP_611753.4 |
AdoMet_MTases |
36..>186 |
CDD:302624 |
|
Antkmt | NP_001120919.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0500 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.