DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art7 and K12D9.1

DIOPT Version :9

Sequence 1:NP_611753.4 Gene:Art7 / 37664 FlyBaseID:FBgn0034817 Length:690 Species:Drosophila melanogaster
Sequence 2:NP_503823.2 Gene:K12D9.1 / 187323 WormBaseID:WBGene00019675 Length:354 Species:Caenorhabditis elegans


Alignment Length:198 Identity:41/198 - (20%)
Similarity:67/198 - (33%) Gaps:79/198 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   397 KRYLRYLEESIEAEKSNVLVLGNGCLLGLASSALGAASVL-LHEPHRF--SRRLIESIVK----- 453
            :||:|        |..|.|..||               :| ::|...|  |:..:|::..     
 Worm    53 ERYVR--------EWCNTLACGN---------------ILEVNEKEEFWISKENVEALTNTSFQL 94

  Fly   454 --HNQLKNV-QFLDKV-----------------EELEDSRLAALTHIFAEPYFLNAILPWDNFYF 498
              |..|..| :.:|.:                 .:.||.: |..|....|.:.::.::|    .|
 Worm    95 MFHTMLPTVLRPIDSLIECFKKDGPYGLDYSIYSDFEDMQ-AMFTKTVYEQHMISGLIP----AF 154

  Fly   499 GTLLTKIKDRLPEGVKISPCSARIYALPVEFLDLHKIRAPVGSCEGFDLRLFDEMVERSAEQAVS 563
            |   ..||::|.:|      ..|:       ||       ||..|||...|..|...:|....:.
 Worm   155 G---NGIKEKLEDG------GFRV-------LD-------VGCGEGFHSCLLAENYSKSQFVGLD 196

  Fly   564 LVE 566
            :.|
 Worm   197 ICE 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art7NP_611753.4 AdoMet_MTases 36..>186 CDD:302624
K12D9.1NP_503823.2 Methyltransf_31 163..>282 CDD:316372 13/57 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.