Sequence 1: | NP_611753.4 | Gene: | Art7 / 37664 | FlyBaseID: | FBgn0034817 | Length: | 690 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_503823.2 | Gene: | K12D9.1 / 187323 | WormBaseID: | WBGene00019675 | Length: | 354 | Species: | Caenorhabditis elegans |
Alignment Length: | 198 | Identity: | 41/198 - (20%) |
---|---|---|---|
Similarity: | 67/198 - (33%) | Gaps: | 79/198 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 397 KRYLRYLEESIEAEKSNVLVLGNGCLLGLASSALGAASVL-LHEPHRF--SRRLIESIVK----- 453
Fly 454 --HNQLKNV-QFLDKV-----------------EELEDSRLAALTHIFAEPYFLNAILPWDNFYF 498
Fly 499 GTLLTKIKDRLPEGVKISPCSARIYALPVEFLDLHKIRAPVGSCEGFDLRLFDEMVERSAEQAVS 563
Fly 564 LVE 566 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Art7 | NP_611753.4 | AdoMet_MTases | 36..>186 | CDD:302624 | |
K12D9.1 | NP_503823.2 | Methyltransf_31 | 163..>282 | CDD:316372 | 13/57 (23%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0500 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |