DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art7 and BUD23

DIOPT Version :9

Sequence 1:NP_611753.4 Gene:Art7 / 37664 FlyBaseID:FBgn0034817 Length:690 Species:Drosophila melanogaster
Sequence 2:XP_006715910.1 Gene:BUD23 / 114049 HGNCID:16405 Length:304 Species:Homo sapiens


Alignment Length:163 Identity:34/163 - (20%)
Similarity:56/163 - (34%) Gaps:57/163 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 IYYIP--KPLQLLEAGKSFHLSCHH--DEYSLWFDAREEAPTKSVRRHTCTCDLHMTYSRSRIGQ 389
            :.|:|  ||..||:.|....||..:  ||...|                             :| 
Human    69 LLYLPENKPCYLLDIGCGTGLSGSYLSDEGHYW-----------------------------VG- 103

  Fly   390 LNQSPRNKRYLRYLEESIEAEKSNVLVLG-------------NGCLLGLASSALGAASVLLHEPH 441
            |:.||      ..|:|:::.|....|:||             :||:...|...|..|:.....|.
Human   104 LDISP------AMLDEAVDREIEGDLLLGDMGQGIPFKPGTFDGCISISAVQWLCNANKKSENPA 162

  Fly   442 R----FSRRLIESIVKHNQLKNVQFLDKVEELE 470
            :    |...|...:|:.::.....:.:..|:||
Human   163 KRLYCFFASLFSVLVRGSRAVLQLYPENSEQLE 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art7NP_611753.4 AdoMet_MTases 36..>186 CDD:302624
BUD23XP_006715910.1 AdoMet_MTases 38..>117 CDD:302624 18/83 (22%)
Methyltransf_11 81..184 CDD:285453 26/138 (19%)
WBS_methylT 227..302 CDD:289366
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.