DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art7 and CARM1

DIOPT Version :9

Sequence 1:NP_611753.4 Gene:Art7 / 37664 FlyBaseID:FBgn0034817 Length:690 Species:Drosophila melanogaster
Sequence 2:NP_954592.1 Gene:CARM1 / 10498 HGNCID:23393 Length:608 Species:Homo sapiens


Alignment Length:452 Identity:95/452 - (21%)
Similarity:160/452 - (35%) Gaps:140/452 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SCFSHVMNPITGQNSWQERGDD---------YDYHLEVANAGFGDMLHDWERNQKYFAALRKTIA 57
            :|..|.:.    ::.:.||.::         |.|..:..|     |:.|:.|...|..|:.:...
Human   126 TCRGHTLE----RSVFSERTEESSAVQYFQFYGYLSQQQN-----MMQDYVRTGTYQRAILQNHT 181

  Fly    58 GMREAGREVHVLDIGTGTGILSMMALAAGADSVTACEAFLPMANCAEKILAANGAGDKVRLIRKR 122
            ..::.    .|||:|.|:||||..|..|||..:.|.|| ..||..||.::.:|...|::.:|..:
Human   182 DFKDK----IVLDVGCGSGILSFFAAQAGARKIYAVEA-STMAQHAEVLVKSNNLTDRIVVIPGK 241

  Fly   123 STEIQVGEDMPRKANLLVAELLDTELIGEGAIGIYNHAHAELLTEDALCIPARARCYAQVAQSPL 187
            ..|:    .:|.:.:::::|.:...|..|..:..|.|                       |:..|
Human   242 VEEV----SLPEQVDIIISEPMGYMLFNERMLESYLH-----------------------AKKYL 279

  Fly   188 AAQWNSLKTIANLDGEPLLHPPEQLKSCQ-------GEAALHDVQLSQLPSSA----FR-PLTDP 240
            ....|...||.::...|.  ..|||...|       .:.:.|.|.||.|..:|    || |:.|.
Human   280 KPSGNMFPTIGDVHLAPF--TDEQLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFRQPVVDT 342

  Fly   241 VEI---------FQFDFQRKQEREKQRSQL-LKLQSKQPGAAELVFYWWDIQLDDDGEIL---LS 292
            .:|         :..:|...:|.:..|.:: .|......|....:.:|:|:..  .|.|:   ||
Human   343 FDIRILMAKSVKYTVNFLEAKEGDLHRIEIPFKFHMLHSGLVHGLAFWFDVAF--IGSIMTVWLS 405

  Fly   293 CAPYWAHPQLKELAAEKAKDHPLPNVVPWRDHWMQAIYYIPKPLQLLEAGKSFHLSCHHDEYSLW 357
            .||                ..||       .||.|.......|| ..:||.:...:|        
Human   406 TAP----------------TEPL-------THWYQVRCLFQSPL-FAKAGDTLSGTC-------- 438

  Fly   358 FDAREEAPTKSVRRHTCTCDLHMTYSRSRIGQLNQSPRNKRYLRYLEESIEAEKSNVLVLGN 419
                           ....:...:|..|.:.|::|:              .::.||:|.|.|
Human   439 ---------------LLIANKRQSYDISIVAQVDQT--------------GSKSSNLLDLKN 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art7NP_611753.4 AdoMet_MTases 36..>186 CDD:302624 36/149 (24%)
CARM1NP_954592.1 CARM1 34..138 CDD:288395 2/15 (13%)
PRMT5 <172..435 CDD:282971 75/322 (23%)
Methyltransf_18 184..283 CDD:289607 32/130 (25%)
Transactivation domain. /evidence=ECO:0000250 499..608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.