DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art7 and PRMT3

DIOPT Version :9

Sequence 1:NP_611753.4 Gene:Art7 / 37664 FlyBaseID:FBgn0034817 Length:690 Species:Drosophila melanogaster
Sequence 2:NP_005779.1 Gene:PRMT3 / 10196 HGNCID:30163 Length:531 Species:Homo sapiens


Alignment Length:352 Identity:69/352 - (19%)
Similarity:130/352 - (36%) Gaps:63/352 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DMLHDWERNQKYFAALRKTIAGMREAGREVHVLDIGTGTGILSMMALAAGADSVTACEAFLPMAN 101
            :||.|..|.:.|    |..|.......::..|||:|.|||||||.|..|||..|...:. ..:..
Human   232 EMLKDKIRTESY----RDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGAKKVLGVDQ-SEILY 291

  Fly   102 CAEKILAANGAGDKVRLIRKRSTEIQVGEDMPRKANLLVAELLDTELIGEGAIGIYNHAHAELLT 166
            .|..|:..|...|.:.||:.:..|:.:..:   |.:::::|.:...|:.|..:....:|..:.|.
Human   292 QAMDIIRLNKLEDTITLIKGKIEEVHLPVE---KVDVIISEWMGYFLLFESMLDSVLYAKNKYLA 353

  Fly   167 EDALCIPARARCYAQVAQSPL------AAQWNSLKTIANLDGEPLLHPPEQLKSCQGEAALHDVQ 225
            :.....|... ..:.||.|.:      .|.|:.:....              .||..:|.:.:..
Human   354 KGGSVYPDIC-TISLVAVSDVNKHADRIAFWDDVYGFK--------------MSCMKKAVIPEAV 403

  Fly   226 LSQLPSSAFRPLTDPVEIFQFDFQRKQEREKQRSQLLKLQSKQPGAAELVFYWWDIQLDDD--GE 288
            :..|.....  :::|..|...|.......:.:.|....|:..:......:..::||..:.:  ..
Human   404 VEVLDPKTL--ISEPCGIKHIDCHTTSISDLEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNR 466

  Fly   289 ILLSCAPYWAHPQLKELAAEKAKDHPLPNVVPWRDHWMQAIYYIPKPLQLLEAGKSF--HLSCHH 351
            ::.|..|.                       ..:.||.|.::.:.||.. ::||::.  .::.|.
Human   467 VVFSTGPQ-----------------------STKTHWKQTVFLLEKPFS-VKAGEALKGKVTVHK 507

  Fly   352 DEYSLWFDAREEAPTKSVRRHTCTCDL 378
            ::.    |.|....|.::...|.|..|
Human   508 NKK----DPRSLTVTLTLNNSTQTYGL 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art7NP_611753.4 AdoMet_MTases 36..>186 CDD:302624 39/148 (26%)
PRMT3NP_005779.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43
AdoMet_MTases 259..359 CDD:100107 29/103 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.