DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art7 and prmt8

DIOPT Version :9

Sequence 1:NP_611753.4 Gene:Art7 / 37664 FlyBaseID:FBgn0034817 Length:690 Species:Drosophila melanogaster
Sequence 2:XP_002938739.2 Gene:prmt8 / 100491340 XenbaseID:XB-GENE-6037618 Length:396 Species:Xenopus tropicalis


Alignment Length:353 Identity:79/353 - (22%)
Similarity:135/353 - (38%) Gaps:86/353 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SC-----FSHVMNPITGQNSWQERGDDYDYHLEVANAGFG---DMLHDWERNQKYFAALRKTIAG 58
            ||     .:.::||        |.....||:.: :.|.||   :||.|..|...|    |.::..
 Frog    56 SCPGRGKMAKLLNP--------EEMTSRDYYFD-SYAHFGIHEEMLKDEVRTLTY----RNSMYH 107

  Fly    59 MREAGREVHVLDIGTGTGILSMMALAAGADSVTACEAFLPMANCAEKILAANGAGDKVRLIRKRS 123
            .:...::..|||:|:|||||||.|..|||..|...|. ..:::.:|||:.||...:.:.:.|.:.
 Frog   108 NKHVFKDKVVLDVGSGTGILSMFAAKAGARKVYGIEC-SSVSDYSEKIIKANHLDNIITIFRGKV 171

  Fly   124 TEIQVGEDMPRKANLLVAELLDTELIGEGAIGIYNHAHAELLTEDALCIPARARCYAQVAQSPLA 188
            .|:::..|   |.::::.|.:...|..|..:.....|..:.|....|..|.||..|....:.   
 Frog   172 EEVELPVD---KVDIIITEWMGYCLFYESMLNTVIFARDKWLKPGGLMFPDRAALYIVAIED--- 230

  Fly   189 AQWNSLKTIANLDGEPLLHPPEQL----KSCQGEAALHDVQLSQLPSSAFRPLTDPVE------- 242
            .|:...|          :|..|.:    .:|     :.||.:.:       ||.|.|:       
 Frog   231 RQYKDFK----------IHWWENVYGFDMTC-----IRDVAIKE-------PLVDIVDPKQVVTN 273

  Fly   243 ---IFQFDFQRKQEREKQRSQLLKLQSKQPGAAELVFYWWDIQLDDDGEILLSCAPYWAHPQLKE 304
               |.:.|....:..|...:....||.::......:..:::|:       ...|     |   |:
 Frog   274 SCLIKEIDIYTVKTEELAFTAAFCLQVQRNDYVHALVTYFNIE-------FTKC-----H---KK 323

  Fly   305 LAAEKAKDHPLPNVVPWRDHWMQAIYYI 332
            .....|.|.|.       .||.|.::|:
 Frog   324 TGFSTAPDAPY-------THWKQTVFYL 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art7NP_611753.4 AdoMet_MTases 36..>186 CDD:302624 43/152 (28%)
prmt8XP_002938739.2 Methyltransf_25 117..214 CDD:379312 31/100 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.