DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art7 and si:ch211-93g23.2

DIOPT Version :9

Sequence 1:NP_611753.4 Gene:Art7 / 37664 FlyBaseID:FBgn0034817 Length:690 Species:Drosophila melanogaster
Sequence 2:NP_001139099.1 Gene:si:ch211-93g23.2 / 100005086 ZFINID:ZDB-GENE-090312-164 Length:274 Species:Danio rerio


Alignment Length:213 Identity:44/213 - (20%)
Similarity:70/213 - (32%) Gaps:79/213 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   370 RRHTCTCDLHMTYSRSRIGQLNQSPRNK---RYLRYLEESIEAEKSNVLVLGNGCLLGLASSALG 431
            :||....|...:|.|.|:     ||..:   ..|.:|.:.|..:..  |.:..||..|..:..|.
Zfish     3 QRHFEGKDHVESYQRHRV-----SPPQELIDEVLNFLRKRINTDLD--LAVDVGCGSGQGTELLA 60

  Fly   432 AASVLLHEPHRFSRRLIESIVKHNQLK-------------------NVQFLDKVEELEDSRLAAL 477
                    |:..:  ::.:.:...|||                   ::.|.|.:.:|..|..|| 
Zfish    61 --------PYFLT--VVGTDISPAQLKIASDKDHPANICYRESPAEDLPFEDSIADLVSSMSAA- 114

  Fly   478 THIFAEPYFLNAILPWDNFYFGTLLTKIKDRLPEGVKISPCSARI-YALPVE------------- 528
             |.|..|.||..:                ||:   :|...|.|.: |.:..|             
Zfish   115 -HWFDHPRFLQEV----------------DRI---LKPGGCLALLSYTMDFELEYGESTSKLNNI 159

  Fly   529 ----FLDLHKIR-APVGS 541
                :..||..| |.:||
Zfish   160 CEEFYAALHPFRKAYIGS 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art7NP_611753.4 AdoMet_MTases 36..>186 CDD:302624
si:ch211-93g23.2NP_001139099.1 SmtA 1..240 CDD:223574 44/213 (21%)
Methyltransf_11 46..138 CDD:285453 23/122 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.