DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art7 and carm1l

DIOPT Version :9

Sequence 1:NP_611753.4 Gene:Art7 / 37664 FlyBaseID:FBgn0034817 Length:690 Species:Drosophila melanogaster
Sequence 2:XP_009303379.2 Gene:carm1l / 100003090 ZFINID:ZDB-GENE-090312-219 Length:450 Species:Danio rerio


Alignment Length:392 Identity:86/392 - (21%)
Similarity:144/392 - (36%) Gaps:130/392 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSCFSHVMNPIT-------------------GQNSWQERGDDYD--YHLEVANAGFGDMLHDWER 44
            :.|||.:|...|                   .|:.:::|.:|..  .:.:..|     ||.|:.|
Zfish    82 LGCFSVLMRFSTQSEFQDFHRMLISWMHLRRDQSVFRQRSEDSSALQYFQQQN-----MLQDFLR 141

  Fly    45 NQKYFAALRKTIAGMREAGREVHVLDIGTGTGILSMMALAAGADSVTACEAFLPMANCAEKILAA 109
            ...|    :|.:....:..::..|||:|.||||||..|:.|||..|.|.|| ..:|..||.::.:
Zfish   142 TATY----QKAMLLNEDDFKDKVVLDVGCGTGILSFFAVQAGAQKVYAVEA-STVAKYAEMLVRS 201

  Fly   110 NGAGDKVRLIRKRSTEIQVGEDMPRKANLLVAELLDTELIGEGAIGIYNHA-------------- 160
            ||..:|:.::..|..|:    ..|.|.:::::|.:...|:.|..:..:.||              
Zfish   202 NGLSNKITVLSGRIEEV----SCPEKVDVIISEPMGYMLLNERMLESFLHAKHWLKPKGMMFPTQ 262

  Fly   161 ---HAELLTEDALCIPARARCYAQVAQSPLAAQWNSLKTIANLDGEPLLHPPEQLKSCQGEAALH 222
               |....|::.|.:...||          :..||                    :||     .:
Zfish   263 SDIHLAPFTDEHLYMEHHAR----------SNFWN--------------------QSC-----FY 292

  Fly   223 DVQLSQLPSSAF-----RPLTDPVEI---------FQFDFQRKQEREKQRSQL---LKLQSKQPG 270
            .|.||.|.|||.     :|:.|..::         :..:|...:|.:..|.::   .||  .|.|
Zfish   293 GVNLSGLHSSAVDEFFKQPIVDTFDMQILMARSVKYTINFLEAKEEDLHRLEIPFVFKL--LQSG 355

  Fly   271 AAELVFYWWDIQ-LDDDGEILLSCAPYWAHPQLKELAAEKAKDHPLPNVVPWRDHWMQAIYYIPK 334
            ....:.:|:|:. :.....|.||.:|                ..||       .||.|....:..
Zfish   356 LIHGLAFWFDVAFVGSKMTIWLSTSP----------------TEPL-------THWYQVRCLLQT 397

  Fly   335 PL 336
            ||
Zfish   398 PL 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art7NP_611753.4 AdoMet_MTases 36..>186 CDD:302624 44/166 (27%)
carm1lXP_009303379.2 PH-like <32..119 CDD:327399 6/36 (17%)
PRMT5 <101..410 CDD:310055 81/373 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.