DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)k09913 and AT2G18245

DIOPT Version :9

Sequence 1:NP_001286754.1 Gene:l(2)k09913 / 37661 FlyBaseID:FBgn0021979 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_565432.1 Gene:AT2G18245 / 816340 AraportID:AT2G18245 Length:398 Species:Arabidopsis thaliana


Alignment Length:287 Identity:49/287 - (17%)
Similarity:95/287 - (33%) Gaps:81/287 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 VLMMAWLMAKQKHLKKYAQIYTEMGFDVVVVHITPWQLLWPVKGSQV------VAAETIRFL--- 203
            |:::.||.||.|||::|.:.|...|.:.|...:....||....|.::      ...|.:.::   
plant   125 VVLLGWLGAKAKHLRRYVEWYNSRGINAVTFTVDVRDLLRLDLGRRLERRIAEFGNELVNWVSEK 189

  Fly   204 ENNKSYEPIVMHGFSVGAYQLGEIMLQMSRDMDRYGSILDRFV-----------C---------- 247
            |::...:.:|.|.||...:.:             ||::|:.|:           |          
plant   190 EDDGREKCLVFHSFSNTGWLV-------------YGALLESFIGRQDLVERIKGCIIDSGGADPL 241

  Fly   248 --QVW---------------------------DSAADITEIPVGVPKSIFPRNERMQSALRNYTL 283
              ::|                           |::....:.|:|:...:....|::.....|   
plant   242 DTKIWAAGFTAAILKKRSSTITTEPNSPIKEEDASTPQKKEPLGIENIMLSSLEKLFPIFLN--- 303

  Fly   284 YHLKTFHNQATIHYMRSSQMFHSTLLKAPALFFVSDNDPIGPPSSNQSVREDWERANIKVTFKCW 348
                  |........:..|..:......|.|:..|..|.:.|..|.:....:.::...|:....:
plant   304 ------HPDVNTRLTKIIQKLYENHPPCPQLYLYSSGDKVVPSHSVELRIREQQKIGRKIHSFNF 362

  Fly   349 ERSQHAAHYIRHREEYLQTLFQHLETC 375
            :.|.|..||....:.|...|...|:.|
plant   363 KSSPHVDHYRNFPDLYSSQLQNFLQEC 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)k09913NP_001286754.1 DUF829 146..372 CDD:283384 47/282 (17%)
AT2G18245NP_565432.1 DUF829 123..386 CDD:399017 47/282 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2521
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916101at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_110151
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.680

Return to query results.
Submit another query.