DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)k09913 and AT2G15695

DIOPT Version :9

Sequence 1:NP_001286754.1 Gene:l(2)k09913 / 37661 FlyBaseID:FBgn0021979 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_565378.1 Gene:AT2G15695 / 816063 AraportID:AT2G15695 Length:420 Species:Arabidopsis thaliana


Alignment Length:266 Identity:60/266 - (22%)
Similarity:105/266 - (39%) Gaps:43/266 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 NPLVLMMAWLMAKQKHLKKYAQIYTEMGFDVVVVHITPWQLLWPVKGSQVVAAETIRFLENNKSY 209
            |.:|::..|....:..|..:..:|:.:|::.:|........::|.....:........:|..||.
plant    29 NGVVVIFVWSSINENQLMNFVDLYSSLGWNSLVCRADFLTAVYPEMALSLAFHLLSELVEELKSR 93

  Fly   210 E-PIVMHGFSVGA-----YQLGEIML-----QMSRDMDRYGSILDRFVC---QVWDSA-ADITEI 259
            . |::...|| ||     |::.::::     |:..|    .|.|.| .|   .|:||. .|.|. 
plant    94 PCPVIFLAFS-GAPKACMYKVLQVIMDDCEAQIHPD----DSQLVR-TCLSGHVYDSGPLDFTS- 151

  Fly   260 PVGVPKSIFPRNERMQSALRNYT------------LYHLKTFHNQATIHYMRSSQMFHSTLLKAP 312
            .:.|..::.|...||....|..:            || |..|.:|.:.::   ..::.|..:.||
plant   152 DLNVKFALHPTIRRMSGPSRLVSWVAKGISSGLDGLY-LTRFESQRSEYW---QALYSSVEIGAP 212

  Fly   313 ALFFVSDNDPIGPPSSNQSVREDWERANIKVTFKCWERSQHAAHYIRHREEYLQTLFQHLETCGV 377
            .|...|:||.:.|.....|.....:....:|....|:.|.||.||..:..:|...:...||    
plant   213 YLILCSENDELAPLQVISSFTHQLQELGGEVKVVKWKNSPHAGHYAHNPIQYRAVISNFLE---- 273

  Fly   378 LEAIGV 383
             :||.|
plant   274 -KAISV 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)k09913NP_001286754.1 DUF829 146..372 CDD:283384 54/252 (21%)
AT2G15695NP_565378.1 DUF829 137..385 CDD:283384 37/152 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2521
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I2653
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.820

Return to query results.
Submit another query.