DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)k09913 and Tmem53

DIOPT Version :9

Sequence 1:NP_001286754.1 Gene:l(2)k09913 / 37661 FlyBaseID:FBgn0021979 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001272741.1 Gene:Tmem53 / 68777 MGIID:1916027 Length:283 Species:Mus musculus


Alignment Length:254 Identity:57/254 - (22%)
Similarity:104/254 - (40%) Gaps:44/254 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 PLVLMMAWLMAKQKHLKKYAQIYTEMGFDVVVVHITPWQLLW-----PVKGSQVVAAETIRFL-E 204
            |:|:::.|...:.|:|.||:.||.:.|. :|:.:..||.:::     .:...:|:|.:.:..| :
Mouse    41 PVVILLGWGGCRDKNLAKYSAIYHKRGC-IVIRYTAPWHMVFFSESLGIPSLRVIAQKLLELLFD 104

  Fly   205 NNKSYEPIVMHGFSVGAYQLGEIMLQMSRDMDRYGSILDRFVCQVWDSAADITEIPVGVPKSIFP 269
            .....||::.|.||.....|...:|::.:...|:..:  ..|..::||....:.: :|..:::..
Mouse   105 YEIEREPLLFHVFSNAGVMLYRYVLELLQTHQRFRHL--HVVGTIFDSGPGDSNL-IGALRALAT 166

  Fly   270 RNERMQSALRNYTLYHLKTFHNQATIHYMRSSQMFHSTLLKAPALFFVSDNDPIGPPSSNQSVRE 334
            ..||..:.||   |..|..|   |.:..     :||..|....|||.....|.:....|......
Mouse   167 ILERRPAVLR---LLLLAAF---ALVVI-----LFHFLLAPFTALFHTHFYDRLQDSGSCWPELY 220

  Fly   335 DWERANIKVTFKCWER-------------------SQHAAHYIRHREEYLQTL---FQH 371
            .:.||:..|:.:..||                   |.|.:| :|....|..:|   |.|
Mouse   221 LYSRADKVVSARDVERMVEARLAHQVMVRGVDFVSSAHVSH-LRDYPTYYTSLCVDFMH 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)k09913NP_001286754.1 DUF829 146..372 CDD:283384 57/254 (22%)
Tmem53NP_001272741.1 DUF829 41..277 CDD:310367 55/251 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2521
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.