DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)k09913 and CG8245

DIOPT Version :9

Sequence 1:NP_001286754.1 Gene:l(2)k09913 / 37661 FlyBaseID:FBgn0021979 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_610178.2 Gene:CG8245 / 35503 FlyBaseID:FBgn0033031 Length:343 Species:Drosophila melanogaster


Alignment Length:349 Identity:72/349 - (20%)
Similarity:128/349 - (36%) Gaps:91/349 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 SLQTGHQQQQQPAPNSAMAPSNNRRYLSSQDITKNMTLYTSTKTQVEVDPKTL----AFKKPTGN 145
            |:...|       |....|.....:|..|....:...|.:|.::.:.....||    .|.||:..
  Fly     2 SISASH-------PCGLNADGTATQYKESTATIQTSGLQSSPRSFLPEREDTLEYFIKFPKPSSK 59

  Fly   146 ----------------PLVLMMAWLMAKQKHLKKYAQIYTEMGFDVVVVHITPWQLLWPVKGSQV 194
                            |:|:::.|...:.::|.||::||.|.|. :.|.:..|...|:..:...:
  Fly    60 NEFVLAKDHDGEDSHVPIVMLLGWAGCQDRYLMKYSKIYEERGL-ITVRYTAPVDSLFWKRSEMI 123

  Fly   195 VAAETIRFLENNKSYE--PIVMHGFS-VGAYQLGEIMLQMSR---DMDRYGSILD---------- 243
            ...|.|..|..:.:::  |::.|.|| .|||....|.|.:.:   .:...|.|.|          
  Fly   124 PIGEKILKLIQDMNFDAHPLIFHIFSNGGAYLYQHINLAVIKHKSPLQVRGVIFDSAPGERRIIS 188

  Fly   244 --RFVCQVWD--------SAADIT---------EIPVGVPKSIFPRNERMQSALRNYTLYHLKTF 289
              |.:..::.        :|..||         |..:...||:|..:    |.:|......||  
  Fly   189 LYRAITAIYGREKRCNCLAALVITITLSIMWFVEESISALKSLFVPS----SPVRPSPFCDLK-- 247

  Fly   290 HNQATIHYMRSSQMFHSTLLKAPALFFVSDNDPIGPPSSNQS---VREDWERANIKVTFKCWERS 351
             |:|.               :.|.||..|..|.:.|....:.   :|.|   ..|:|:..|:|.:
  Fly   248 -NEAN---------------RYPQLFLYSKGDIVIPYRDVEKFIRLRRD---QGIQVSSVCFEDA 293

  Fly   352 QHAAHYIRHREEYLQTLFQHLETC 375
            :|...|.::.::|:|.:...:..|
  Fly   294 EHVKIYTKYPKQYVQCVCNFIRNC 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)k09913NP_001286754.1 DUF829 146..372 CDD:283384 58/263 (22%)
CG8245NP_610178.2 DUF829 76..314 CDD:283384 58/263 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2521
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916101at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.