DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)k09913 and Tmem53

DIOPT Version :9

Sequence 1:NP_001286754.1 Gene:l(2)k09913 / 37661 FlyBaseID:FBgn0021979 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001101434.1 Gene:Tmem53 / 313529 RGDID:1307066 Length:276 Species:Rattus norvegicus


Alignment Length:246 Identity:53/246 - (21%)
Similarity:107/246 - (43%) Gaps:28/246 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 PLVLMMAWLMAKQKHLKKYAQIYTEMGFDVVVVHITPWQLLW-----PVKGSQVVAAETIRFL-E 204
            |:|:::.|...:.|:|.||:.||.:.|. :|:.:..||.:::     .:...:|||.:.:..| :
  Rat    34 PVVILLGWGGCRDKNLAKYSAIYHKRGC-IVIRYTAPWHMVFFSESLGIPSLRVVAQKLLELLFD 97

  Fly   205 NNKSYEPIVMHGFSVGAYQLGEIMLQMSRDMDRYGSILDRFVCQVWDSAADITEIPVGVPKSIFP 269
            .....||::.|.||.....|...:|::.:...|:..:  ..|..::||....::: :|..:::..
  Rat    98 YEIEREPLLFHVFSNAGVMLYRYVLELLQTHQRFRHL--HVVGTIFDSGPGDSDL-IGALRALAT 159

  Fly   270 RNERMQSALRNYTLYHLKTFHNQATI-HYMRS--SQMFHSTLLKA--------PALFFVSDNDPI 323
            ..||..:.||   |..|..|.....: |::.:  :.:||:.....        |.|:..|..|.:
  Rat   160 ILERRPAVLR---LLLLAAFALVVVLFHFLFAPFTALFHTHFYDRLQDSGSCWPELYLYSRADKV 221

  Fly   324 GPPSSNQSVREDWERANIKVTFKCWERSQHAAHYIRHREEYLQTL---FQH 371
            ......:.:.|:.....:.|....:..|.|.:| :|....|..:|   |.|
  Rat   222 VSARDVERMVEERLAHQVSVRGVDFVTSAHVSH-LRDYPTYYTSLCVDFMH 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)k09913NP_001286754.1 DUF829 146..372 CDD:283384 53/246 (22%)
Tmem53NP_001101434.1 DUF829 34..270 CDD:283384 51/243 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2521
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916101at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.