DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)k09913 and T10B11.5

DIOPT Version :9

Sequence 1:NP_001286754.1 Gene:l(2)k09913 / 37661 FlyBaseID:FBgn0021979 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_491979.1 Gene:T10B11.5 / 188370 WormBaseID:WBGene00020401 Length:280 Species:Caenorhabditis elegans


Alignment Length:280 Identity:54/280 - (19%)
Similarity:107/280 - (38%) Gaps:56/280 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 PKTLA--FKKPTGNPLVLMMAWLMAKQKHLKKYAQIYTEMGFDVVVVHITPWQLLWPVKGSQVV- 195
            ||.:.  .|:.|   :|.::.|..|..::::|||.||.:.|:..|..........|..|..:.| 
 Worm     4 PKAIVRHGKRDT---IVALLGWAGAVDRNVEKYAGIYQKKGYTTVQFTALAAVKGWGTKDGRNVD 65

  Fly   196 -AAETIRFLENNKSYEPIVMHGFSVGAY--------QLGEIMLQMSRD----------------- 234
             .|.|:..:..|.| ..:|.|.||:..:        |..|:......|                 
 Worm    66 HLASTLDSVLINPS-NRLVFHVFSMNGFIALTSLDSQFPELKAIEKCDGIFMDSCPACFSFSIEN 129

  Fly   235 MDRYGSILDRFVCQVWDSAADITEIPVGVPKSIFPRNERMQSALRNYTLYHLKTFHNQATIHYMR 299
            |.::..:::    .|:|.....:...:|   :.:...::.::|...|.:. :.|...:|.:..:.
 Worm   130 MQKHALVMN----HVYDQLIKNSNFVLG---NFYKVYKKWETARFGYQMI-MDTMSIKAGLCTIE 186

  Fly   300 SSQMFHSTLLKAPAL-----FFVSDNDPIGPPSS----NQ--SVREDWERANIKVTFKCWERSQH 353
            .:..|. .||..|.|     ...||||.:.....    |:  :.:.|.:|..:....|   .:.|
 Worm   187 EANPFF-YLLNHPHLPPILTSIFSDNDIVCSADEINLFNECAAKKSDKKRQIMATRLK---DTAH 247

  Fly   354 AAHYIRHREEYLQTLFQHLE 373
            ..|:.::.:.||:.:.:.|:
 Worm   248 VEHFRKYPKLYLEKMDEFLQ 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)k09913NP_001286754.1 DUF829 146..372 CDD:283384 49/263 (19%)
T10B11.5NP_491979.1 DUF829 15..266 CDD:283384 50/266 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2521
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916101at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.